Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0308
         (755 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC048980-1|AAH48980.1|  574|Homo sapiens protein kinase, AMP-act...    31   5.9  

>BC048980-1|AAH48980.1|  574|Homo sapiens protein kinase,
           AMP-activated, alpha 1 catalytic subunit protein.
          Length = 574

 Score = 30.7 bits (66), Expect = 5.9
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 4/61 (6%)
 Frame = -2

Query: 727 HIVKL----SCSQDTVLVVEFFFKSETADYLLATGR*DDVPNSAR*ISPGRDEPKSKNSL 560
           HI+KL    S   D  +V+E+    E  DY+   GR  DVP   +  S    + K    L
Sbjct: 86  HIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRL 145

Query: 559 F 557
           F
Sbjct: 146 F 146


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,589,625
Number of Sequences: 237096
Number of extensions: 1788991
Number of successful extensions: 3298
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3158
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3298
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 9127122082
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)