BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0306 (573 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 23 2.8 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 2.8 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 8.7 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.6 bits (46), Expect = 2.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 217 GKTNLSHDGLNPAHVPF*WVNNPTLGEFSS 128 GK N +PA PF W ++ + G FSS Sbjct: 404 GKENYQTMSRDPARTPFQWDDSVSAG-FSS 432 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.6 bits (46), Expect = 2.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 217 GKTNLSHDGLNPAHVPF*WVNNPTLGEFSS 128 GK N +PA PF W ++ + G FSS Sbjct: 404 GKENYQTMSRDPARTPFQWDDSVSAG-FSS 432 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 479 VEAHLDRGDRAIGFF 523 VEAHL +G AIG + Sbjct: 188 VEAHLRKGRGAIGAY 202 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,325 Number of Sequences: 438 Number of extensions: 2774 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -