BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0302 (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 23 1.6 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 23 1.6 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 23 1.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.7 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 4.9 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -2 Query: 360 GDWGLQLSPINEEFLVSASHK 298 G G+Q+SP NE +V++S++ Sbjct: 52 GFGGVQISPPNENLVVTSSNR 72 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -2 Query: 360 GDWGLQLSPINEEFLVSASHK 298 G G+Q+SP NE +V++S++ Sbjct: 53 GFGGVQISPPNENLVVTSSNR 73 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -2 Query: 360 GDWGLQLSPINEEFLVSASHK 298 G G+Q+SP NE +V++S++ Sbjct: 53 GFGGVQISPPNENLVVTSSNR 73 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 139 TTFTSSK*SSLVNFPTTPTAVKPPRV 216 TT T+++ + N+PT T + PP V Sbjct: 1067 TTSTTTR-PTTTNWPTQGTTIPPPAV 1091 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.8 bits (44), Expect = 4.9 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +1 Query: 181 PTTPTAVKPPRVGPKTSLNHSIGSRTGGVYKGQGRNQRELMT 306 PT T+ PP V K R G G N L+T Sbjct: 225 PTPSTSASPPTVNIKKESPQMQSYRPTGNITPHGSNTSSLIT 266 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,033 Number of Sequences: 336 Number of extensions: 2920 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -