BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0302 (643 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 3e-17 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 8e-17 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 1e-16 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 9e-15 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 75 4e-14 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 72 5e-13 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 72 5e-13 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 72 5e-13 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 71 8e-13 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 71 8e-13 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 70 1e-12 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 70 2e-12 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 70 2e-12 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 67 1e-11 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 67 1e-11 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 66 3e-11 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 63 2e-10 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 55 4e-08 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57049| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 42 6e-04 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_13868| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 40 0.001 SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) 33 0.26 SB_4970| Best HMM Match : IBV_3C (HMM E-Value=2.2) 29 3.2 SB_46123| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_42351| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_42677| Best HMM Match : TUDOR (HMM E-Value=0) 28 5.6 SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) 28 7.4 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_47928| Best HMM Match : VWA (HMM E-Value=0.00018) 27 9.8 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 92.7 bits (220), Expect = 2e-19 Identities = 49/69 (71%), Positives = 52/69 (75%) Frame = -2 Query: 462 MPLDVLGRTSATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALIT 283 MPLDVL RT ATL S P P G GN +K RAGD LQL +NEEFLVSASH+LALIT Sbjct: 1 MPLDVLDRTRATLTVSRVFPSPEGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALIT 60 Query: 282 SLPFVHTAR 256 SLPFVHTAR Sbjct: 61 SLPFVHTAR 69 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 88.6 bits (210), Expect = 4e-18 Identities = 49/70 (70%), Positives = 53/70 (75%), Gaps = 1/70 (1%) Frame = -2 Query: 462 MPLDVLGRTSATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 286 MPLDVLGRT ATL S + R G GN +K RAGD LQL +NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRTRATLTVSTSLSFARKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALI 60 Query: 285 TSLPFVHTAR 256 TSLPFVHTAR Sbjct: 61 TSLPFVHTAR 70 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 85.8 bits (203), Expect = 3e-17 Identities = 46/69 (66%), Positives = 50/69 (72%) Frame = -2 Query: 462 MPLDVLGRTSATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALIT 283 MPLDVLGRT ATL S + G GN +K RAGD +L NEEFLVSASH+LALIT Sbjct: 1 MPLDVLGRTRATLTVSTSLSFAGGVGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALIT 60 Query: 282 SLPFVHTAR 256 SLPFVHTAR Sbjct: 61 SLPFVHTAR 69 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 84.2 bits (199), Expect = 8e-17 Identities = 47/70 (67%), Positives = 51/70 (72%), Gaps = 1/70 (1%) Frame = -2 Query: 462 MPLDVLGRTSATLKESACSPWPR-GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 286 MPLDVLGR TL S + R G GN +K RAGD LQL +NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRPRVTLTVSTSLSFRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALI 60 Query: 285 TSLPFVHTAR 256 TSLPFVHTAR Sbjct: 61 TSLPFVHTAR 70 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 83.4 bits (197), Expect = 1e-16 Identities = 47/70 (67%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = -2 Query: 462 MPLDVLGRTSA-TLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALI 286 MPLDVLGRT T + P P G GN +K RAGD LQL NEEFLVSASH+LALI Sbjct: 1 MPLDVLGRTRRYTDGVNESFPRPEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALI 60 Query: 285 TSLPFVHTAR 256 TSLPFVHTAR Sbjct: 61 TSLPFVHTAR 70 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 77.4 bits (182), Expect = 9e-15 Identities = 41/63 (65%), Positives = 44/63 (69%) Frame = -2 Query: 444 GRTSATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVH 265 GRT ATL P P G GN +K RAGD +L NEEFLVSASH+LALITSLPFVH Sbjct: 4 GRTRATLTGQRVFPSPEGGGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLPFVH 63 Query: 264 TAR 256 TAR Sbjct: 64 TAR 66 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 75.4 bits (177), Expect = 4e-14 Identities = 45/71 (63%), Positives = 49/71 (69%), Gaps = 2/71 (2%) Frame = -2 Query: 462 MPLDVLGRTSATLKESACSPWPR--GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLAL 289 MPLDVLGR A + + R G GN +K RAGD LQL NEEFLVSASH+LAL Sbjct: 1 MPLDVLGR-HARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLAL 59 Query: 288 ITSLPFVHTAR 256 ITSLPFVHTAR Sbjct: 60 ITSLPFVHTAR 70 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 71.7 bits (168), Expect = 5e-13 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -2 Query: 423 KESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 169 RKATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 224 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 71.7 bits (168), Expect = 5e-13 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -2 Query: 426 LKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 ++++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 124 IRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 180 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 71.7 bits (168), Expect = 5e-13 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -2 Query: 423 KESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 77 RKATCARCFAGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 132 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 71.7 bits (168), Expect = 5e-13 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = -2 Query: 426 LKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 ++++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 129 IRKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 185 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 71.3 bits (167), Expect = 6e-13 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = -2 Query: 399 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 P+G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 102 PQGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 149 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 70.9 bits (166), Expect = 8e-13 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -2 Query: 423 KESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 77 RKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 132 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 70.9 bits (166), Expect = 8e-13 Identities = 36/57 (63%), Positives = 43/57 (75%) Frame = -2 Query: 426 LKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 ++++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 124 IRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 180 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 70.9 bits (166), Expect = 8e-13 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -2 Query: 423 KESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +++ C+ G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 51 RKATCARCFAGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 106 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.9 bits (166), Expect = 8e-13 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 399 PRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 P+G GN +K RAGD LQL +NEEFLVSA+H+LALITSLPFVHTAR Sbjct: 42 PQGVGNLVKHRRAGDRSLQLLILNEEFLVSANHQLALITSLPFVHTAR 89 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 70.5 bits (165), Expect = 1e-12 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 396 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 67 KGVGNLVKYRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 113 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 70.1 bits (164), Expect = 1e-12 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 423 KESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 130 RKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 185 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 70.1 bits (164), Expect = 1e-12 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 423 KESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 77 RKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 132 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 70.1 bits (164), Expect = 1e-12 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 423 KESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +++ C+ G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 77 RKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 132 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 69.7 bits (163), Expect = 2e-12 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 396 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 67 Score = 33.5 bits (73), Expect = 0.15 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 2/80 (2%) Frame = -1 Query: 451 CPGPHERYTEGISMFSLA*R-PGQPAETPSCWGLGF-AIIPHKRGIPSKRES*ARVDYVP 278 C GPH RYT+G++ L + G + +I ++ + S A + +P Sbjct: 2 CSGPHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 61 Query: 277 ALCTHRPSYYRLNDLVRSSD 218 + T R YYRLN LVR SD Sbjct: 62 FVHTAR-RYYRLNGLVRPSD 80 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 69.7 bits (163), Expect = 2e-12 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 396 RGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +G GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 21 KGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 67 Score = 33.5 bits (73), Expect = 0.15 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 2/80 (2%) Frame = -1 Query: 451 CPGPHERYTEGISMFSLA*R-PGQPAETPSCWGLGF-AIIPHKRGIPSKRES*ARVDYVP 278 C GPH RYT+G++ L + G + +I ++ + S A + +P Sbjct: 2 CSGPHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLP 61 Query: 277 ALCTHRPSYYRLNDLVRSSD 218 + T R YYRLN LVR SD Sbjct: 62 FVHTAR-RYYRLNGLVRPSD 80 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 6e-12 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = -2 Query: 393 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 G GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 22 GVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 67 Score = 33.1 bits (72), Expect = 0.20 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 2/80 (2%) Frame = -1 Query: 451 CPGPHERYTEGIS-MFSLA*RPGQPAETPSCWGLGF-AIIPHKRGIPSKRES*ARVDYVP 278 C GPH RYT+G++ F G + +I ++ + S A + +P Sbjct: 2 CSGPHARYTDGVNESFLSTEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLP 61 Query: 277 ALCTHRPSYYRLNDLVRSSD 218 + T R YYRLN LVR SD Sbjct: 62 FVHTAR-RYYRLNGLVRPSD 80 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 67.7 bits (158), Expect = 7e-12 Identities = 35/56 (62%), Positives = 42/56 (75%) Frame = -2 Query: 423 KESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 +++ C+ G GN +K RA D LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 77 RKATCARCFAGVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 132 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 67.3 bits (157), Expect = 1e-11 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 387 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 46 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 179 KLTKLDHLEEVKVVTRFP 126 K+ + DHLEEVKVVTRFP Sbjct: 73 KVGQTDHLEEVKVVTRFP 90 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 67.3 bits (157), Expect = 1e-11 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 387 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 46 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 67.3 bits (157), Expect = 1e-11 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 387 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 GN +K RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 3 GNLVKHRRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 46 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -2 Query: 387 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 46 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -2 Query: 387 GNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 GN +K RAGD LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 3 GNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 46 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 65.7 bits (153), Expect = 3e-11 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = -2 Query: 393 GPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 G GN +K RA D LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 138 GVGNLVKHRRARDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 183 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 63.3 bits (147), Expect = 2e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 366 RAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTAR 256 RAGD LQL +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 85 RAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTAR 121 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 55.2 bits (127), Expect = 4e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 348 LQLSPINEEFLVSASHKLALITSLPFVHTAR 256 LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLPFVHTAR 60 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 55.2 bits (127), Expect = 4e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 348 LQLSPINEEFLVSASHKLALITSLPFVHTAR 256 LQL NEEFLVSASH+LALITSLPFVHTAR Sbjct: 30 LQLLIFNEEFLVSASHQLALITSLPFVHTAR 60 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 52.8 bits (121), Expect = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 333 INEEFLVSASHKLALITSLPFVHTAR 256 +NEEFLVSASH+LALITSLPFVHTAR Sbjct: 7 LNEEFLVSASHQLALITSLPFVHTAR 32 >SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KAFAKGVFINQERKLEVRRRLDTALVLTVN 92 KAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 14 KAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KAFAKGVFINQERKLEVRRRLDTALVLTVN 92 KAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 14 KAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KAFAKGVFINQERKLEVRRRLDTALVLTVN 92 KAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 14 KAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KAFAKGVFINQERKLEVRRRLDTALVLTVN 92 KAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 14 KAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KAFAKGVFINQERKLEVRRRLDTALVLTVN 92 KAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 33 KAFAKNVFINQERKLEDRRRSDTVLVLTIN 62 >SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 KAFAKGVFINQERKLEVRRRLDTALVLTVN 92 KAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 16 KAFAKNVFINQERKLEDRRRSDTVLVLTIN 45 >SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +3 Query: 3 KAFAKGVFINQERKLEVRRRLDTALVLTVN 92 ++ AK VFINQERKLE RRR DT LVLT+N Sbjct: 14 ESIAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +3 Query: 3 KAFAKGVFINQERKLEVRRRLDTALVLTVN 92 ++ + VFINQERKLE RRR DT LVLT+N Sbjct: 14 ESICQDVFINQERKLEDRRRSDTVLVLTIN 43 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 3 KAFAKGVFINQERKLEVRRRLDT 71 KAFAK VFINQERKLE RRR DT Sbjct: 6 KAFAKNVFINQERKLEDRRRSDT 28 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_57049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = +3 Query: 123 LRKPCYDFYFL*MIKFGQLPNN 188 LRKPCYDFYFL MIKF QL +N Sbjct: 3 LRKPCYDFYFLYMIKFDQLFDN 24 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 40 VSASHQLALITSLPFVHTAR 59 Score = 37.5 bits (83), Expect = 0.009 Identities = 32/78 (41%), Positives = 41/78 (52%), Gaps = 2/78 (2%) Frame = -1 Query: 445 GPHERYTEGISMFSLA*RPGQPAETPSCWGLGFAIIPHKRGIPSKRES*--ARVDYVPAL 272 GPH RYT+G++ L + W + AII +RGIPS S A + +P + Sbjct: 7 GPHARYTDGVNESFLRRK---------AWII--AIIDLERGIPSVSASHQLALITSLPFV 55 Query: 271 CTHRPSYYRLNDLVRSSD 218 T R YYRLN LVR SD Sbjct: 56 HTAR-RYYRLNGLVRPSD 72 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 15 VSASHQLALITSLPFVHTAR 34 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/42 (50%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -1 Query: 337 PHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 P +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 7 PLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 47 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 92 VSASHQLALITSLPFVHTAR 111 Score = 29.9 bits (64), Expect = 1.8 Identities = 22/44 (50%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSS 221 AII +RGIPS S A + +P + T R YYRLN LVR S Sbjct: 81 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPS 123 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 315 VSASHKLALITSLPFVHTAR 256 VSASH+LALITSLPFVHTAR Sbjct: 14 VSASHQLALITSLPFVHTAR 33 Score = 32.3 bits (70), Expect = 0.34 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -1 Query: 346 AIIPHKRGIPSKRES*--ARVDYVPALCTHRPSYYRLNDLVRSSD 218 AII +RGIPS S A + +P + T R YYRLN LVR SD Sbjct: 3 AIIDLERGIPSVSASHQLALITSLPFVHTAR-RYYRLNGLVRPSD 46 >SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +3 Query: 24 FINQERKLEVRRRLDTALVLTVN 92 FINQERKLE RRR DT LVLT+N Sbjct: 21 FINQERKLEDRRRSDTVLVLTIN 43 >SB_13868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 41.1 bits (92), Expect = 7e-04 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +3 Query: 108 PSAGS-LRKPCYDFYFL*MIKFGQLPNN 188 PSAGS PCYDFYFL MIKF QL +N Sbjct: 3 PSAGSPYENPCYDFYFLKMIKFDQLFDN 30 >SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +3 Query: 24 FINQERKLEVRRRLDTALVLTVN 92 FINQERKLE RRR DT LVLT+N Sbjct: 21 FINQERKLEDRRRSDTVLVLTIN 43 >SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +3 Query: 24 FINQERKLEVRRRLDTALVLTVN 92 FINQERKLE RRR DT LVLT+N Sbjct: 21 FINQERKLEDRRRSDTVLVLTIN 43 >SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 Query: 255 DGRCVQRAGT*STRAYDSRLLGIPR 329 DGRCVQRAGT S D RLLGIPR Sbjct: 43 DGRCVQRAGTQSMHIDDMRLLGIPR 67 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/40 (55%), Positives = 26/40 (65%) Frame = +3 Query: 297 AYDSRLLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENML 416 A DSRLLGIPR IIA PQH+ VS P L A+E ++ Sbjct: 85 ADDSRLLGIPRSRSIIAMIYPQHDDVSQDYPRLPAKERLV 124 >SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 416 DSFSVALVRPRTSKGITD 469 D+ SVA VRPRTSKGITD Sbjct: 34 DTVSVARVRPRTSKGITD 51 >SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 416 DSFSVALVRPRTSKGITD 469 D+ SVA VRPRTSKGITD Sbjct: 132 DTVSVARVRPRTSKGITD 149 >SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 416 DSFSVALVRPRTSKGITD 469 D+ SVA VRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 416 DSFSVALVRPRTSKGITD 469 D+ SVA VRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 33.1 bits (72), Expect = 0.20 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 416 DSFSVALVRPRTSKGITD 469 D+ SVA VRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 >SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) Length = 86 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 416 DSFSVALVRPRTSKGITD 469 D+ SVA VRPRTSKGITD Sbjct: 64 DTVSVAHVRPRTSKGITD 81 >SB_4970| Best HMM Match : IBV_3C (HMM E-Value=2.2) Length = 1094 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 148 TSSK*SSLVNFPTTPTAVKPPRVGPKTSLNHSIGSRTGGVYKGQG 282 TS++ S + ++ T+ +V P G S NH + Y+GQG Sbjct: 170 TSTESSGMGSYSTSDHSVSGPNPGDAHSFNHRGAPKASHPYRGQG 214 >SB_46123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +3 Query: 267 VQRAGT*STRAYDSRLLGIPRLW---GIIANPNPQHEGVS 377 VQ G TR+Y S L +W G+ NP+PQ +G S Sbjct: 535 VQTVGKAPTRSYHSCTLYRGEMWVIGGVYPNPDPQPDGCS 574 >SB_42351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 249 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -2 Query: 372 LLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVHTARP 253 LL D+GL S I + ++ + A+IT+LP VH ++P Sbjct: 4 LLSLADYGLGDSDIEDSDEEASKGEPAVITTLPKVHVSQP 43 >SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 416 DSFSVALVRPRTSKGITD 469 D+ SVA VR +TSKGITD Sbjct: 64 DTVSVARVRAKTSKGITD 81 >SB_42677| Best HMM Match : TUDOR (HMM E-Value=0) Length = 1150 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -2 Query: 432 ATLKESACSPWPRGPGNPLKLLRA---GDWGLQLSPINEEF 319 AT+++ P+P G LK++ W L L PIN EF Sbjct: 326 ATVQKVYLKPYPLADGTSLKVIVTEVISPWELWLQPINTEF 366 >SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 462 MPLDVLGRTSATLKES 415 MPLDVLGRT ATL S Sbjct: 1 MPLDVLGRTRATLTVS 16 >SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) Length = 792 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 332 MGDNCKPQSPARRSFSGLPGPLGQGEHADSFSVALVRPR 448 MG PQ P + + G+PGP G G A + + A+ R Sbjct: 307 MGPRGSPQGPPQVT-PGMPGPAGMGAAAAAAAAAMAAAR 344 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 27.5 bits (58), Expect = 9.8 Identities = 22/53 (41%), Positives = 26/53 (49%) Frame = +2 Query: 266 CTKGRDVINASL*LALTRNSSFMGDNCKPQSPARRSFSGLPGPLGQGEHADSF 424 C K RD + L LA T S +G N KP+ RRS GL PL G + F Sbjct: 1152 CNKPRDCVRRFL-LAATTPSP-IGCN-KPRDCVRRSPIGLNKPLEPGSYDTGF 1201 >SB_47928| Best HMM Match : VWA (HMM E-Value=0.00018) Length = 139 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 21 VFINQERKLEVRRRLDTALVLTVNMSSNDPSAGSLRK 131 +F+N+ RRR+D A V+ + S D + G +++ Sbjct: 18 LFVNRSESSPCRRRMDVAFVIDRSASMGDENFGYIKQ 54 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 462 MPLDVLGRTSATL 424 MPLDVLGRT ATL Sbjct: 1 MPLDVLGRTRATL 13 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,076,100 Number of Sequences: 59808 Number of extensions: 399682 Number of successful extensions: 1288 Number of sequences better than 10.0: 104 Number of HSP's better than 10.0 without gapping: 1070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1279 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -