BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0302 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 2.0 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 25 2.0 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 8.2 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 335 GDNCKPQSPARRSFSGLPGPLG 400 G C P+ A + GLPGP+G Sbjct: 91 GGCCLPKCFAEKGNRGLPGPMG 112 Score = 23.4 bits (48), Expect = 6.2 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +2 Query: 272 KGRDVINASL*LALTRNSSFMGDNCKPQSPARRSFSGLPGPLGQ 403 KG +V A+ T GD +P P R G G GQ Sbjct: 287 KGEEVYGATGTTTTTGPKGEKGDRGEPGEPGRSGEKGQAGDRGQ 330 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 25.0 bits (52), Expect = 2.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 166 SLVNFPTTPTAVKPPRVGPKTS 231 SLVN T T PP V P TS Sbjct: 397 SLVNGGTPSTTTMPPSVAPTTS 418 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 357 DWGLQLSPINEEFLVSASHK 298 D GL+++P EF++ +SH+ Sbjct: 670 DNGLKIAPTKTEFIMVSSHQ 689 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,677 Number of Sequences: 2352 Number of extensions: 12146 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -