BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0301 (725 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.0 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 442 RTESCRSRTKRNRHD 398 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 442 RTESCRSRTKRNRHD 398 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 442 RTESCRSRTKRNRHD 398 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 442 RTESCRSRTKRNRHD 398 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 442 RTESCRSRTKRNRHD 398 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 442 RTESCRSRTKRNRHD 398 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 442 RTESCRSRTKRNRHD 398 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 271 TNSLKRHNARTSTRPGTGRIRFPSKPDTPRSS 176 T+++ A T+ RPGT + KP P +S Sbjct: 1103 TSTVTAAAAATNIRPGTADNKPQLKPQKPFTS 1134 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,078 Number of Sequences: 438 Number of extensions: 4916 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -