BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0300 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.3 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 30 1.7 At1g76965.1 68414.m08961 glycine-rich protein 29 2.3 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 29 3.0 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 29 3.0 At5g02040.2 68418.m00125 prenylated rab acceptor (PRA1) family p... 27 9.1 At5g02040.1 68418.m00124 prenylated rab acceptor (PRA1) family p... 27 9.1 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 314 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 430 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +3 Query: 297 TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 431 T+ T SG R++L+ R+ D HD + PFNG T Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 190 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 95 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -3 Query: 256 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 80 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -3 Query: 256 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 80 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g02040.2 68418.m00125 prenylated rab acceptor (PRA1) family protein contains Pfam PF03208: PRA1 family protein Length = 209 Score = 27.5 bits (58), Expect = 9.1 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -1 Query: 651 WNLVNPFMRVT-N*MTRHLATLRES*LLPPFTRACLNFFTLTFRALGRN 508 W + + +RV+ + HLAT+ + L P +A N F FRA+ RN Sbjct: 157 WYISSGLLRVSVALLIAHLATILHASLRTPNLKARFNTFREEFRAVWRN 205 >At5g02040.1 68418.m00124 prenylated rab acceptor (PRA1) family protein contains Pfam PF03208: PRA1 family protein Length = 209 Score = 27.5 bits (58), Expect = 9.1 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -1 Query: 651 WNLVNPFMRVT-N*MTRHLATLRES*LLPPFTRACLNFFTLTFRALGRN 508 W + + +RV+ + HLAT+ + L P +A N F FRA+ RN Sbjct: 157 WYISSGLLRVSVALLIAHLATILHASLRTPNLKARFNTFREEFRAVWRN 205 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,939,227 Number of Sequences: 28952 Number of extensions: 335180 Number of successful extensions: 832 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 832 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -