BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0299 (735 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_13633| Best HMM Match : Glyco_hydro_31 (HMM E-Value=0) 29 5.2 SB_40326| Best HMM Match : PhoU (HMM E-Value=2.9) 28 6.8 SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 >SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -1 Query: 162 SWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 SWI RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 4 SWIYERRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 147 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 147 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 147 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 147 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 11 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 45 >SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 6e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 144 RTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 RT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 29 RTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 62 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 144 RTSAKAFAKGVFINQERKLEVRRRLDT 64 RT+AKAFAK VFINQERKLE RRR DT Sbjct: 2 RTTAKAFAKNVFINQERKLEDRRRSDT 28 >SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.0 bits (109), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -1 Query: 147 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 R+T+ ++ AK VFINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESIAKNVFINQERKLEDRRRSDTVLVLTIN 43 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 169 VKFLDRRKTNISESICQRCFHQSRTKV 89 VKFLD RKTN ESI + F K+ Sbjct: 2 VKFLDLRKTNYCESIAKNVFINQERKL 28 >SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/36 (61%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = -1 Query: 147 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 R+T+ ++ + VFINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQDVFINQERKLEDRRRSDTVLVLTIN 43 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 169 VKFLDRRKTNISESICQRCFHQSRTKV 89 VKFLD RKTN ESICQ F K+ Sbjct: 2 VKFLDLRKTNYCESICQDVFINQERKL 28 >SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -1 Query: 147 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 166 KFLDRRKTNISESICQRCFHQSRTKV 89 + L RKTN ESICQ CF K+ Sbjct: 3 EILGFRKTNYCESICQECFINQERKL 28 >SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -1 Query: 147 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -3 Query: 169 VKFLDRRKTNISESICQRCFHQSRTKV 89 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 >SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -1 Query: 147 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 43 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -3 Query: 169 VKFLDRRKTNISESICQRCFHQSRTKV 89 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 >SB_13633| Best HMM Match : Glyco_hydro_31 (HMM E-Value=0) Length = 663 Score = 28.7 bits (61), Expect = 5.2 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 276 RNIQAAFLARFEHSNLFK--VKLSAHLDTHRRAPR*DFDIEPAFFRTPAHRRYA 431 +N + LAR+ + +F ++ AHLDT RR P D+ R RYA Sbjct: 573 KNPEPELLARWYQTGVFTPFLRAHAHLDTKRREPWLFDDVYKNVIRDALRTRYA 626 >SB_40326| Best HMM Match : PhoU (HMM E-Value=2.9) Length = 672 Score = 28.3 bits (60), Expect = 6.8 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 5/79 (6%) Frame = +3 Query: 111 KHLWQMLSLMFVLRRSKNFTSNVAIRMPPVIPINHYLGVLKTNKIEPRHI-----LLFHA 275 KH + SL F LR +T + + + +I + L L N IEP+H+ L Sbjct: 363 KHNKSLRSLNFSLRE---WTVDCVMAIADMISTSTLLKELTINDIEPQHVDVIANALIDN 419 Query: 276 RNIQAAFLARFEHSNLFKV 332 +I+ LARF ++L K+ Sbjct: 420 VSIKTLTLARFPGNSLVKI 438 >SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 230 QNSEVMINRDNWGHSY-CDVRGEILGSSQDEHQRKHLP 120 Q EV +++ GH Y C GE++ S++D H+ +P Sbjct: 7 QCKEVESSKEILGHPYVCAFAGEVIQSTEDVHKPSWIP 44 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,872,686 Number of Sequences: 59808 Number of extensions: 433515 Number of successful extensions: 1083 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -