BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0297 (729 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 26 0.36 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 3.3 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 25.8 bits (54), Expect = 0.36 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 259 FVQNNTYYYYYQLVNDFLGLY 321 FVQ N Y YYQ+++ G++ Sbjct: 152 FVQRNQEYKYYQILSHLSGIF 172 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 22.6 bits (46), Expect = 3.3 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +1 Query: 529 NNCLEILY*NRQCQIIKLK---SFSSATECI 612 NNC +Y R+CQ +LK S EC+ Sbjct: 228 NNCEIDMYMRRKCQECRLKKCLSVGMRPECV 258 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,417 Number of Sequences: 336 Number of extensions: 3212 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -