BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0297 (729 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|... 26 4.8 SPBC17G9.11c |pyr1||pyruvate carboxylase|Schizosaccharomyces pom... 25 8.4 >SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1174 Score = 26.2 bits (55), Expect = 4.8 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 127 LSRSKYGIYVLSRCLGYKLILYKFIYKTEFLFKHLYLI 240 L ++ G YVL RC+ + L+L K L K+++ I Sbjct: 950 LPYTQEGNYVLVRCIAFNLMLQAGALKYTPLIKYIFYI 987 >SPBC17G9.11c |pyr1||pyruvate carboxylase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1185 Score = 25.4 bits (53), Expect = 8.4 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -3 Query: 187 VLVYNPNSATVHIFRIYFDLRINHVIIYSF 98 VLV N + + +FR +L ++ V IYS+ Sbjct: 36 VLVANRSEIAIRVFRTAHELSMHTVAIYSY 65 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,563,337 Number of Sequences: 5004 Number of extensions: 50065 Number of successful extensions: 61 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -