BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0291 (306 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 0.64 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 25 0.85 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 25 0.85 AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 25 0.85 AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding pr... 25 0.85 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 25 0.85 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 1.5 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 2.0 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 2.6 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 2.6 AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 23 3.4 AF457556-1|AAL68786.1| 65|Anopheles gambiae salivary gland 7-l... 23 3.4 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 22 4.5 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 22 4.5 AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-tran... 22 4.5 AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-tran... 22 4.5 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 22 4.5 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 22 6.0 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 22 6.0 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 22 6.0 AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 21 7.9 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 21 7.9 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 21 7.9 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 21 7.9 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 21 7.9 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 21 7.9 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 21 7.9 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 0.64 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -2 Query: 74 RELCRDSRYHLCMGGY-CCKWSHQC 3 ++LC +++ L MGG+ KW+ C Sbjct: 882 KQLCEETKAALAMGGFPLRKWASNC 906 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 24.6 bits (51), Expect = 0.85 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -2 Query: 191 CSNTSSGTSYSHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSR 51 C+ ++ T +SHC+C + G +L+ + GP ++C + R Sbjct: 183 CTPNATNTVWSHCQCVLAD--GVERGILTVNRMIPGPSI-QVCENDR 226 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 24.6 bits (51), Expect = 0.85 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -2 Query: 191 CSNTSSGTSYSHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSR 51 C+ ++ T +SHC+C + G +L+ + GP ++C + R Sbjct: 183 CTPNATNTVWSHCQCVLAD--GVERGILTVNRMIPGPSI-QVCENDR 226 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 24.6 bits (51), Expect = 0.85 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 206 EGAEDCSNTSSGTSYSHCRCTSTNE 132 +GAEDCS++ TS H + T E Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLE 75 >AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding protein OBP5470 protein. Length = 144 Score = 24.6 bits (51), Expect = 0.85 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 206 EGAEDCSNTSSGTSYSHCRCTSTNE 132 +GAEDCS++ TS H + T E Sbjct: 14 DGAEDCSSSVDETSEPHDKMMCTLE 38 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 24.6 bits (51), Expect = 0.85 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 206 EGAEDCSNTSSGTSYSHCRCTSTNE 132 +GAEDCS++ TS H + T E Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLE 75 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.8 bits (49), Expect = 1.5 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -2 Query: 161 SHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSRYHLCMGGY 27 S+CR T+ R N L RCGL G R +++ LC G + Sbjct: 519 SNCRSTA-----DRQN-LCIRCGLTGHKARSCQNEAKCALCGGAH 557 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 196 SAPSSSAMPGTPPSSSSCSQRHHKTEQTHSLRQG 297 S PSS MPG P+ S ++ T L +G Sbjct: 360 SPPSSLGMPGNIPNLSQLDATGGQSASTSGLPRG 393 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/22 (31%), Positives = 10/22 (45%) Frame = +2 Query: 143 WCSDSGSSWFRSWYWNSLRLPH 208 WCS G+ W+ + R H Sbjct: 70 WCSTDGAHGLMLWFCRTARTKH 91 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 83 PHCRELCRDSRYH 45 P CR +C D+R H Sbjct: 858 PICRAICEDTRVH 870 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 22.6 bits (46), Expect = 3.4 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +1 Query: 28 YPPIHRWY 51 YP +HRWY Sbjct: 183 YPNVHRWY 190 >AF457556-1|AAL68786.1| 65|Anopheles gambiae salivary gland 7-like protein protein. Length = 65 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 47 GTCCPYTALCSAVLP 91 G CCP+ L +A LP Sbjct: 21 GLCCPWIDLAAADLP 35 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 15 PLAAVPTHTQMVPA 56 PLA PT TQ PA Sbjct: 44 PLAPYPTETQRAPA 57 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 15 PLAAVPTHTQMVPA 56 PLA PT TQ PA Sbjct: 44 PLAPYPTETQRAPA 57 >AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-transferase D1-3 protein. Length = 218 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 19 LQQYPPIHRWY 51 L++Y IHRWY Sbjct: 181 LRRYENIHRWY 191 >AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 19 LQQYPPIHRWY 51 L++Y IHRWY Sbjct: 181 LRRYENIHRWY 191 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 22.2 bits (45), Expect = 4.5 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -2 Query: 242 LLEGGVPGIADDEGAEDCSNTSSGTSYSHCRCTSTNEFGSR 120 L E G P +AD++ +D TS YS R TS + G R Sbjct: 1088 LAEQGAPRVADNQHNQDNDRTS---LYS-ARNTSEEQRGRR 1124 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 42 VYGWVLLQVVAPV 4 V GW+LL VAP+ Sbjct: 3224 VDGWILLAQVAPI 3236 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 193 SSAPSSSAMPGTPPSSSSCSQRHHKTEQTHSL 288 ++A +S++ P T PS+S R QT+++ Sbjct: 159 AAAGASASTPPTIPSASPSPTRSTDLSQTYAI 190 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 212 DDEGAEDCSNTSSGTSYSHCRCTST 138 D+E A+ N + Y H C +T Sbjct: 98 DEELAKQAGNNARSCQYQHDSCRNT 122 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 187 EQSSAPSSSAMPGTPPSSSSCS 252 +QSS+ SSS+ + SSSS S Sbjct: 107 QQSSSSSSSSSSSSMSSSSSSS 128 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 15 PLAAVPTHTQMVPA 56 PLA PT TQ PA Sbjct: 43 PLAPYPTETQRSPA 56 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 15 PLAAVPTHTQMVPA 56 PLA PT TQ PA Sbjct: 43 PLAPYPTETQRSPA 56 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 15 PLAAVPTHTQMVPA 56 PLA PT TQ PA Sbjct: 43 PLAPYPTETQRSPA 56 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 15 PLAAVPTHTQMVPA 56 PLA PT TQ PA Sbjct: 43 PLAPYPTETQRSPA 56 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 15 PLAAVPTHTQMVPA 56 PLA PT TQ PA Sbjct: 115 PLAPYPTETQRSPA 128 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 15 PLAAVPTHTQMVPA 56 PLA PT TQ PA Sbjct: 114 PLAPYPTETQRSPA 127 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 359,086 Number of Sequences: 2352 Number of extensions: 6488 Number of successful extensions: 39 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19992474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -