BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0290 (699 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 31 0.21 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.64 SPCC584.16c |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 26 4.5 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 6.0 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 7.9 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 7.9 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 30.7 bits (66), Expect = 0.21 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 427 SGCGRCRVWSMFVRYVRFSELVF*YNAAQKLYIF 528 +GCG+ VW +VR+V F E + LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.64 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 610 ARKIRGRPENAGPDPVRNVRRFSRV 536 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPCC584.16c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 231 Score = 26.2 bits (55), Expect = 4.5 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -2 Query: 281 TGATSPRTSSPEFSRSAESIRTPPQMRCSS--RSEPYLPSIGF 159 + ++S +SSP RS+ +TPP S + P+ P +GF Sbjct: 3 SSSSSSGSSSPASKRSSRKRQTPPMPELPSFLLAFPHAPPLGF 45 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 6.0 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -2 Query: 206 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 69 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 7.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 464 TNIDQTRHRPHPLPVQTRHAPV 399 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 7.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 352 FPYLHYSID*RLFTLETCCGYGYEPARHL 266 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,993,618 Number of Sequences: 5004 Number of extensions: 63940 Number of successful extensions: 188 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 188 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -