BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0290 (699 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 1.2 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 2.8 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 6.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.4 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -2 Query: 275 ATSPRTSSPEFSRSAESIRTPPQMRCSSRSEPYLPSIGFH 156 ++S T+SP S + +R CS + P+ + FH Sbjct: 324 SSSTTTTSPMTSTKSTIVRNHLNSTCSVTNSPHQKKLRFH 363 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.0 bits (47), Expect = 2.8 Identities = 22/77 (28%), Positives = 31/77 (40%), Gaps = 4/77 (5%) Frame = -2 Query: 275 ATSPRTSSPEFSRSAESIRTPP---QMRCSSRSEPYLP-SIGFHGTRTLRQKRKLFPDLS 108 A S TS+P F A+ P ++ + + P S+ F G Q PDL+ Sbjct: 284 AESEHTSTPNFLSEAKIFPPTPGSFNFSMAALATEHTPLSVKFPGMGHGLQP----PDLA 339 Query: 107 AASSGHFGLPRRTLVFK 57 S G GLP L + Sbjct: 340 GTSQGSAGLPSAILAMR 356 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -2 Query: 188 SEPYLPSIGFHGTRTLRQKRKLFPDLSA 105 SE P+ HG R RQ+ + D + Sbjct: 472 SENNYPTTSIHGDRLQRQREEALADFKS 499 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/29 (24%), Positives = 16/29 (55%) Frame = -2 Query: 299 LRIWVRTGATSPRTSSPEFSRSAESIRTP 213 ++ W+ G T ++ S+ +++RTP Sbjct: 513 IKEWIERGTTKSMEAANIMSKLPKTVRTP 541 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,309 Number of Sequences: 438 Number of extensions: 5348 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -