BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0290 (699 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 2.2 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 3.9 At5g42370.1 68418.m05159 expressed protein 29 3.9 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 3.9 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.2 At4g21520.1 68417.m03110 transducin family protein / WD-40 repea... 28 6.8 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 6.8 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 6.8 At5g22390.1 68418.m02612 expressed protein 27 9.0 At5g16770.2 68418.m01964 myb family transcription factor (MYB9) ... 27 9.0 At5g16770.1 68418.m01963 myb family transcription factor (MYB9) ... 27 9.0 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 448 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 353 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 235 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 101 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 174 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 64 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +1 Query: 37 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 168 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 230 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 132 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At4g21520.1 68417.m03110 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to guanine nucleotide-binding protein beta 5 (GI:1001939) [Mesocricetus auratus] Length = 425 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 211 GGVRILSADLENSGEDVRGDVAPVRTH 291 GG+++ S + ++S +R DV+P RTH Sbjct: 12 GGLKVESGEQKSSWPTMRFDVSPYRTH 38 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 457 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 338 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 457 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 338 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 109 ERSGKSFLFCLSVRVPWNPIEG 174 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At5g16770.2 68418.m01964 myb family transcription factor (MYB9) contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 336 Score = 27.5 bits (58), Expect = 9.0 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 2/91 (2%) Frame = -2 Query: 500 Y*NTNSLKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLE 321 Y NT+ K+ + ID HRP +T H VL A P L +L+ Sbjct: 107 YWNTHLRKKLLQMGIDPVTHRP-----RTDHLNVLAALPQLIAAANFNSLLNLNQNVQLD 161 Query: 320 ALHL--GDLLRIWVRTGATSPRTSSPEFSRS 234 A L LL ++ +T+ T++P FS S Sbjct: 162 ATTLAKAQLLHTMIQVLSTNNNTTNPSFSSS 192 >At5g16770.1 68418.m01963 myb family transcription factor (MYB9) contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 336 Score = 27.5 bits (58), Expect = 9.0 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 2/91 (2%) Frame = -2 Query: 500 Y*NTNSLKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLE 321 Y NT+ K+ + ID HRP +T H VL A P L +L+ Sbjct: 107 YWNTHLRKKLLQMGIDPVTHRP-----RTDHLNVLAALPQLIAAANFNSLLNLNQNVQLD 161 Query: 320 ALHL--GDLLRIWVRTGATSPRTSSPEFSRS 234 A L LL ++ +T+ T++P FS S Sbjct: 162 ATTLAKAQLLHTMIQVLSTNNNTTNPSFSSS 192 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,202,305 Number of Sequences: 28952 Number of extensions: 359109 Number of successful extensions: 1087 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1087 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -