BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0289 (635 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0005 - 16886553-16886946,16887079-16887404 31 1.0 07_03_0794 + 21562995-21563004,21564151-21565799 29 4.1 >01_05_0005 - 16886553-16886946,16887079-16887404 Length = 239 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +3 Query: 453 RYAPQTCQYHRGCGHRQRGHKCNYELFNRNNFSIRYWSWNYRGC 584 R A Y C G +C R+N S RYW W GC Sbjct: 64 RDAAAVTAYREDCPFLDPGFQCISN--GRSNSSFRYWRWQPHGC 105 >07_03_0794 + 21562995-21563004,21564151-21565799 Length = 552 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 184 DPRISPLTSQYECPQLSLLIITSDSEN 264 D +PL+SQ+EC LS L T D+++ Sbjct: 23 DSPYTPLSSQFECDNLSALTNTPDNQS 49 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,888,090 Number of Sequences: 37544 Number of extensions: 314040 Number of successful extensions: 761 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -