BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0263 (545 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0078 + 17931998-17932062,17933320-17933416,17933506-179336... 29 1.8 04_04_1624 - 34849385-34849410,34849748-34851052,34852121-348522... 29 3.2 >01_05_0078 + 17931998-17932062,17933320-17933416,17933506-17933601, 17933957-17933988,17935143-17935595,17935831-17935975, 17936058-17936159,17937798-17937890,17939448-17939489, 17940092-17940202,17940446-17940517,17940596-17940714, 17940981-17941044,17941133-17942782 Length = 1046 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +3 Query: 315 SEKNTSLTRFLSGMALYSAFSCHRSLLLKLVPTIRSLHCITQTKDKNMKIKTGAN 479 S+ ++ F+ G YS+F H + + KLV + LHC + D + GAN Sbjct: 331 SKLRVYISPFIYGTR-YSSFGRHFTKVEKLVEIVDKLHCYVEPGDTIVDFCCGAN 384 >04_04_1624 - 34849385-34849410,34849748-34851052,34852121-34852294, 34852386-34852456,34852563-34852618,34853047-34853185, 34853310-34853695,34853801-34853851,34853936-34854021, 34854112-34854553,34856241-34856315,34856457-34856593, 34856679-34856838,34856917-34857012,34857093-34857247, 34857900-34858032 Length = 1163 Score = 28.7 bits (61), Expect = 3.2 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = +3 Query: 300 SCCPGSEKNTSLTRFLSGMALYSAFSCHRSLLLKLVPTIRSLH 428 S P +E T+++R L G + S +R+LLL LVP +R+LH Sbjct: 803 SVAPYAEA-TNVSRVLVGDEVIS--QANRTLLLSLVPAMRNLH 842 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,056,693 Number of Sequences: 37544 Number of extensions: 269817 Number of successful extensions: 597 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1222086348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -