BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0263 (545 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37006| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-22) 29 2.5 SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_37006| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-22) Length = 407 Score = 29.1 bits (62), Expect = 2.5 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = -2 Query: 520 HCGKVLKKNNNKMKFAPVLIFIFLSLVCVIQCKDLIVGTSFNKRLLW 380 H L+KNNN M F L +++ + CVIQ IV S N +L+ Sbjct: 53 HAPAKLRKNNNNMWFIDYLRTLYI-VNCVIQPIFAIVAVSTNTLVLY 98 >SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 384 RSLLLKLVPTIRSLHCITQTKDKNMKIKTGANFILL 491 R +K +PTI+ I +KD +MK KT + ++L Sbjct: 7 REKSIKFLPTIKHNRTIQASKDHDMKFKTFSKPLML 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,623,816 Number of Sequences: 59808 Number of extensions: 310698 Number of successful extensions: 620 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -