BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0252 (744 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_4198| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_55932| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) 28 9.2 >SB_17542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +2 Query: 581 RVLSVALSESNISREHTTLIRTAHDLIIDH 670 ++++ + ++NIS +T +IRT+H II H Sbjct: 30 KMMTAKMLDTNISTINTAVIRTSHSHIISH 59 >SB_4198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1001 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/50 (26%), Positives = 29/50 (58%) Frame = -1 Query: 330 IDLLFGNLKILFYIILNSLCENAGILLFNIQHNFIVFIKLFFHFKTASNL 181 +D+ F L+++ I+++LC N + NI N + + + ++ TAS++ Sbjct: 891 LDISFCGLEVVSGDIISALCMNTILKSLNIAGNRLAYFQFSYNQGTASSI 940 >SB_55932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 545 KLEIAHILIIRTRVLSVALSESNISREHTTLIRTAH 652 +L AH +I T +L ++++ HT+L+RT H Sbjct: 76 RLYYAHAIITHTSLLRTRRYYAHVAITHTSLLRTRH 111 >SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) Length = 332 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = -2 Query: 170 KFRKMNRLRKDRGEKIRLFPSRVHFYSIELINRKMHFYSPLASSVRFKRTFLNVRI 3 K R++N LRK R ++++ R+H L K LA SV++K T L + Sbjct: 58 KEREINNLRKTRNDEVKKLKERIHV----LEEEKKRLEEELA-SVKYKLTALESEV 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,129,342 Number of Sequences: 59808 Number of extensions: 376344 Number of successful extensions: 697 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -