BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0250 (633 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0861 + 8153108-8153266,8154633-8155136 28 5.4 06_02_0092 - 11624905-11625123,11625206-11625292,11625767-116258... 28 7.1 04_03_0946 + 20975955-20976095,20976189-20976330,20976449-209765... 28 7.1 03_04_0201 - 18409088-18409306,18409389-18409475,18409950-184100... 28 7.1 11_01_0515 + 4003167-4003229,4003318-4003738,4004224-4004367,400... 27 9.4 10_05_0074 - 8865884-8866567,8866612-8866923 27 9.4 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 27 9.4 03_02_0578 + 9603118-9605633,9605766-9605781 27 9.4 >12_01_0861 + 8153108-8153266,8154633-8155136 Length = 220 Score = 28.3 bits (60), Expect = 5.4 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = -1 Query: 168 PITRPRKSPVSLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNP--DSPLPVTTM 1 P ++ R +P SL + G RL S +VA+ + P P S+P D P TT+ Sbjct: 86 PSSQLRAAPRSLLSSPSPHCQEGHDPRLCVSAGLVAIPRCPPPTSSPSLDPPESSTTV 143 >06_02_0092 - 11624905-11625123,11625206-11625292,11625767-11625889, 11625992-11626351,11626427-11626511,11626603-11626661, 11627173-11627265,11627360-11627464,11627539-11627636, 11627811-11627916,11628009-11628131,11628986-11629021, 11629113-11629310,11629415-11629612,11629917-11630056, 11630181-11630322,11630416-11630556 Length = 770 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -1 Query: 138 SLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTM 1 ++ F T S +GS F+R+ + DVV + +A +P LP T + Sbjct: 428 AIVFSTLSFSGSSIFSRMARAFDVVIIDEAAQAVGDP-VQLPATVI 472 >04_03_0946 + 20975955-20976095,20976189-20976330,20976449-20976588, 20976893-20977090,20977195-20977392,20977484-20977519, 20978374-20978496,20978589-20978694,20978869-20978966, 20979041-20979145,20979240-20979332,20979842-20979900, 20979984-20980068,20980144-20980503,20980606-20980728, 20981203-20981289,20981372-20981590 Length = 770 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -1 Query: 138 SLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTM 1 ++ F T S +GS F+R+ + DVV + +A +P LP T + Sbjct: 428 AIVFSTLSFSGSSIFSRMARAFDVVIIDEAAQAVGDP-VQLPATVI 472 >03_04_0201 - 18409088-18409306,18409389-18409475,18409950-18410072, 18410175-18410534,18410610-18410694,18410780-18410838, 18411350-18411442,18411537-18411641,18411716-18411813, 18411988-18412093,18412186-18412308,18413163-18413198, 18413290-18413487,18413592-18413789,18414094-18414233, 18414356-18414497,18414591-18414731 Length = 770 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -1 Query: 138 SLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTM 1 ++ F T S +GS F+R+ + DVV + +A +P LP T + Sbjct: 428 AIVFSTLSFSGSSIFSRMARAFDVVIIDEAAQAVGDP-VQLPATVI 472 >11_01_0515 + 4003167-4003229,4003318-4003738,4004224-4004367, 4004474-4004556,4004661-4004775,4005309-4005400, 4005558-4005612,4005689-4005834,4005888-4006001, 4006149-4006342,4006985-4007112,4008526-4008583, 4009800-4009876,4010214-4010263,4010336-4010515, 4010633-4010731,4010816-4011133,4011221-4011281, 4011693-4012781,4012951-4013005,4013133-4013291, 4013923-4014442 Length = 1406 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 10/39 (25%) Frame = -3 Query: 148 ESRIVIFRHYLPCREWVICA----------PAAFLGCGS 62 +SR++IF HY C + ++C+ PAAF+G S Sbjct: 524 DSRVIIFAHYRECVKEILCSLRNIDGELVRPAAFIGQSS 562 >10_05_0074 - 8865884-8866567,8866612-8866923 Length = 331 Score = 27.5 bits (58), Expect = 9.4 Identities = 20/68 (29%), Positives = 28/68 (41%) Frame = +2 Query: 338 TRLRSISSVNRRSKKRRFNIKILSRCSSVSVEVGRQFYFEQIRVLKAG*KCCLNISCWNN 517 T S S+ + RF+ I RC +VS G F R + G +++S W Sbjct: 143 TTASSTSTATQHGLGVRFSSAISRRCDAVSAVSGANFADGWSRAMGGG---AVSLSAWFG 199 Query: 518 RI*SRFYC 541 I SR C Sbjct: 200 TIYSRTAC 207 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 81 PSLDVVAVSQAPSPESNPDSPLP 13 P LD ++Q PSP +NP P P Sbjct: 55 PPLDEETLAQFPSPPTNPSPPPP 77 >03_02_0578 + 9603118-9605633,9605766-9605781 Length = 843 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 179 VYSFRLRGLVRVPYRYFSSLPPVPGVGNLRAC 84 VY + +G +R + Y S LPP+P L AC Sbjct: 581 VYEYMAKGTLR-SHLYGSDLPPLPWKQRLEAC 611 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,961,210 Number of Sequences: 37544 Number of extensions: 350680 Number of successful extensions: 993 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 993 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -