BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0246 (589 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0610 - 26108546-26108671,26108739-26108789,26109410-261095... 30 1.6 01_03_0303 + 14792842-14792949,14793659-14793760,14794657-147948... 29 2.7 04_02_0031 + 8874025-8874180,8882152-8882550,8882651-8882987,888... 28 6.3 >03_05_0610 - 26108546-26108671,26108739-26108789,26109410-26109542, 26109633-26109682 Length = 119 Score = 29.9 bits (64), Expect = 1.6 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 5/92 (5%) Frame = +2 Query: 134 DDLDIEALVGNIDSLKAFIGCF--LETSPCDAVSGDFKKDIPELWQKHVANVLQPRNIYS 307 D ++ +G++D + G F S GD + LWQK A +L + S Sbjct: 28 DHASVQINIGHVDENGLYDGRFTTFALSGFIRAQGDADSALDRLWQKRKAELLDTMPVIS 87 Query: 308 NVSLKSSRTSY---LKNTKPSKLNTIPKESIS 394 +LK+ R + + PS+L +S+S Sbjct: 88 AGTLKALRLDFPGVNPDNVPSELKLFITKSVS 119 >01_03_0303 + 14792842-14792949,14793659-14793760,14794657-14794800, 14794906-14794986,14795078-14795147,14795267-14795337, 14795427-14795594,14796030-14796074,14796449-14796511, 14796594-14796869,14797858-14797971,14798099-14798225, 14798315-14798484,14798743-14798841,14799577-14799630, 14801487-14801522,14801741-14801844,14801952-14802186, 14802377-14802609,14802846-14803346,14803422-14803716, 14805796-14805881,14806952-14807064,14807303-14807385, 14808014-14808866,14809215-14809364,14809963-14811146 Length = 1854 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 251 PELWQKHVANVLQPRNIYSNVSLKSSRTSYLK 346 PELW+ ++N+LQP ++ +L S +S L+ Sbjct: 823 PELWRMWISNLLQPLFVHCQQALDFSWSSLLR 854 >04_02_0031 + 8874025-8874180,8882152-8882550,8882651-8882987, 8883234-8884060 Length = 572 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/72 (20%), Positives = 35/72 (48%) Frame = -2 Query: 234 SPETASQGDVSKKHPIKAFRESIFPTKASISRSSFSELYVSLQ*TAANSAKHST*KPFIL 55 SPE Q + H I ++F +A R + S+ + + N + + +PFI+ Sbjct: 137 SPELQRQYEALDAHTIITGLRNMFEDQARAERFNTSKSLFACRLAEVNPSLPPSFEPFIM 196 Query: 54 NYSLQLIRKIIL 19 N++++ + + ++ Sbjct: 197 NFNMKNLNRTLI 208 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,528,584 Number of Sequences: 37544 Number of extensions: 291157 Number of successful extensions: 717 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -