Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0240
         (385 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_0629 - 20076676-20080390,20080508-20080576,20081335-20081660     27   6.7  

>07_03_0629 - 20076676-20080390,20080508-20080576,20081335-20081660
          Length = 1369

 Score = 26.6 bits (56), Expect = 6.7
 Identities = 12/36 (33%), Positives = 22/36 (61%)
 Frame = +1

Query: 34  KKLNSIFFIKETVYISSNLSYKSSIKRLMIMLPLYS 141
           K++   F +   VY+S N+S K  I+R+++ L  +S
Sbjct: 455 KRVKMCFDLTAWVYVSDNISGKQIIQRIIMSLEPWS 490


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,307,727
Number of Sequences: 37544
Number of extensions: 54497
Number of successful extensions: 121
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 121
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 121
length of database: 14,793,348
effective HSP length: 74
effective length of database: 12,015,092
effective search space used: 636799876
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)