BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0233 (553 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81042-7|CAE46660.1| 371|Caenorhabditis elegans Hypothetical pr... 30 1.3 Z73976-9|CAA98280.2| 371|Caenorhabditis elegans Hypothetical pr... 30 1.3 Z49126-1|CAA88938.2| 605|Caenorhabditis elegans Hypothetical pr... 27 9.0 >Z81042-7|CAE46660.1| 371|Caenorhabditis elegans Hypothetical protein T07C12.11 protein. Length = 371 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 111 FGL*GLEIPTVVFKIDIGSR*FSEKLLLIIAVLF 212 F + +EI V++KI+ G +SE +L+I VLF Sbjct: 302 FAMARVEISKVLYKIEFGDNQYSEPVLIIKCVLF 335 >Z73976-9|CAA98280.2| 371|Caenorhabditis elegans Hypothetical protein T07C12.11 protein. Length = 371 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 111 FGL*GLEIPTVVFKIDIGSR*FSEKLLLIIAVLF 212 F + +EI V++KI+ G +SE +L+I VLF Sbjct: 302 FAMARVEISKVLYKIEFGDNQYSEPVLIIKCVLF 335 >Z49126-1|CAA88938.2| 605|Caenorhabditis elegans Hypothetical protein DH11.1 protein. Length = 605 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 235 TILSRLTSKRTAMMSNSFSEN*REPMSILNTTVGISSPYK 116 +++ R+ S+RT + + MS+ NT GIS+PY+ Sbjct: 10 SVMYRIPSERTLESLHEMIGSRMSKMSLKNTLRGISNPYE 49 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,040,141 Number of Sequences: 27780 Number of extensions: 245991 Number of successful extensions: 755 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -