BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0226 (623 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.047 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) 29 4.1 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 7.1 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_55246| Best HMM Match : DUF1168 (HMM E-Value=0.32) 27 9.4 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 399 DVVAVSQAPSPESNPDSPLPVTTM 328 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 390 AVSQAPSPESNPDSPLPVTTM 328 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 35.5 bits (78), Expect = 0.035 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +3 Query: 507 LNILTRNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAF 623 ++++ R +WRASL Y K+VAVKKLVV F Sbjct: 56 MHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGF 94 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.047 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 389 PFLRLPLRNRTLIPRYP 339 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = +3 Query: 522 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAF 623 R +WRASL Y K+VAVKKLVV F Sbjct: 14 RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGF 47 >SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) Length = 203 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -1 Query: 620 CNYELFNRNNFSIRYWSWNYRGCWH 546 C + RN +RYW W R C H Sbjct: 91 CEVTVIARNILPVRYWIWLSRKCGH 115 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 408 PSLDVVAVSQAPSPESNPDSPLP 340 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 534 RASLXXXXXXXXXXXXYTKIVAVKKLVVAF 623 RASL Y K+VAVKKLVV F Sbjct: 5 RASLVPAAAVIPAPIAYIKVVAVKKLVVGF 34 >SB_55246| Best HMM Match : DUF1168 (HMM E-Value=0.32) Length = 943 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +1 Query: 400 QGRQQARK--LPTPGTGGSDEK*RYGTLTRPRNRN 498 QGR + RK L PG GGSD K R + RN Sbjct: 136 QGRDEVRKAILDIPGEGGSDMKSRLQREVQEARRN 170 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,016,192 Number of Sequences: 59808 Number of extensions: 407721 Number of successful extensions: 1059 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1059 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -