BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0226 (623 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ... 33 1.1 >AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor marker CA125 protein. Length = 22152 Score = 32.7 bits (71), Expect = 1.1 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = -3 Query: 477 KSPVSLFFVTT---SRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVA 319 ++P + ++TT SG F+ + PS+ + + SPES P SPLPVT ++ + Sbjct: 5614 RTPGDVSWMTTPPVEETSSG-FSLMSPSMTSPSPVSSTSPESIPSSPLPVTALLTS 5668 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,790,509 Number of Sequences: 237096 Number of extensions: 1914874 Number of successful extensions: 4727 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4727 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6747805200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -