BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0224 (634 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF101312-2|AAC69222.2| 475|Caenorhabditis elegans Hypothetical ... 30 1.2 L16621-4|AAO12390.1| 1595|Caenorhabditis elegans Hypothetical pr... 27 8.4 L16621-3|AAL00883.1| 1620|Caenorhabditis elegans Hypothetical pr... 27 8.4 >AF101312-2|AAC69222.2| 475|Caenorhabditis elegans Hypothetical protein F56E10.3 protein. Length = 475 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 241 FMKHFLFRKLKWNFRYCFKQYCEFYQVFFKISSLMNN 131 F+K +F L WN Y FK + F+ + ++ + + N Sbjct: 7 FLKLAIFETLFWNLSYIFKHFQNFFGILTQLLATVKN 43 >L16621-4|AAO12390.1| 1595|Caenorhabditis elegans Hypothetical protein ZK688.5b protein. Length = 1595 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -3 Query: 101 YENELRFTINSLEFFSVSTRLG 36 +E +R TIN++ F S STRLG Sbjct: 229 FEQVVRETINNISFLSDSTRLG 250 >L16621-3|AAL00883.1| 1620|Caenorhabditis elegans Hypothetical protein ZK688.5a protein. Length = 1620 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -3 Query: 101 YENELRFTINSLEFFSVSTRLG 36 +E +R TIN++ F S STRLG Sbjct: 229 FEQVVRETINNISFLSDSTRLG 250 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,633,522 Number of Sequences: 27780 Number of extensions: 239942 Number of successful extensions: 545 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1395683256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -