BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0222 (723 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL590642-2|CAH70770.1| 862|Homo sapiens CDK5 regulatory subunit... 30 9.6 AL590642-1|CAH70769.1| 1893|Homo sapiens CDK5 regulatory subunit... 30 9.6 AL391870-2|CAI40926.1| 862|Homo sapiens CDK5 regulatory subunit... 30 9.6 AL391870-1|CAI40925.1| 1893|Homo sapiens CDK5 regulatory subunit... 30 9.6 AL353736-2|CAI40654.1| 862|Homo sapiens CDK5 regulatory subunit... 30 9.6 AL353736-1|CAI40653.1| 1893|Homo sapiens CDK5 regulatory subunit... 30 9.6 AL138836-2|CAI16964.1| 862|Homo sapiens CDK5 regulatory subunit... 30 9.6 AL138836-1|CAI16963.1| 1893|Homo sapiens CDK5 regulatory subunit... 30 9.6 AF448860-1|AAP41926.1| 1893|Homo sapiens hypothetical protein pr... 30 9.6 >AL590642-2|CAH70770.1| 862|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 862 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 254 VESAALSGW*TPSKAKYDRETDSEQVP*GKVEKNFEERVQEYVKPFRGKPAKL 412 V S L G + + +RET++ Q+ K +FEER+Q + R K ++ Sbjct: 254 VSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREI 306 >AL590642-1|CAH70769.1| 1893|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1893 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 254 VESAALSGW*TPSKAKYDRETDSEQVP*GKVEKNFEERVQEYVKPFRGKPAKL 412 V S L G + + +RET++ Q+ K +FEER+Q + R K ++ Sbjct: 254 VSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREI 306 >AL391870-2|CAI40926.1| 862|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 862 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 254 VESAALSGW*TPSKAKYDRETDSEQVP*GKVEKNFEERVQEYVKPFRGKPAKL 412 V S L G + + +RET++ Q+ K +FEER+Q + R K ++ Sbjct: 254 VSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREI 306 >AL391870-1|CAI40925.1| 1893|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1893 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 254 VESAALSGW*TPSKAKYDRETDSEQVP*GKVEKNFEERVQEYVKPFRGKPAKL 412 V S L G + + +RET++ Q+ K +FEER+Q + R K ++ Sbjct: 254 VSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREI 306 >AL353736-2|CAI40654.1| 862|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 862 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 254 VESAALSGW*TPSKAKYDRETDSEQVP*GKVEKNFEERVQEYVKPFRGKPAKL 412 V S L G + + +RET++ Q+ K +FEER+Q + R K ++ Sbjct: 254 VSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREI 306 >AL353736-1|CAI40653.1| 1893|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1893 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 254 VESAALSGW*TPSKAKYDRETDSEQVP*GKVEKNFEERVQEYVKPFRGKPAKL 412 V S L G + + +RET++ Q+ K +FEER+Q + R K ++ Sbjct: 254 VSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREI 306 >AL138836-2|CAI16964.1| 862|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 862 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 254 VESAALSGW*TPSKAKYDRETDSEQVP*GKVEKNFEERVQEYVKPFRGKPAKL 412 V S L G + + +RET++ Q+ K +FEER+Q + R K ++ Sbjct: 254 VSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREI 306 >AL138836-1|CAI16963.1| 1893|Homo sapiens CDK5 regulatory subunit associated protein 2 protein. Length = 1893 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 254 VESAALSGW*TPSKAKYDRETDSEQVP*GKVEKNFEERVQEYVKPFRGKPAKL 412 V S L G + + +RET++ Q+ K +FEER+Q + R K ++ Sbjct: 254 VSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREI 306 >AF448860-1|AAP41926.1| 1893|Homo sapiens hypothetical protein protein. Length = 1893 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 254 VESAALSGW*TPSKAKYDRETDSEQVP*GKVEKNFEERVQEYVKPFRGKPAKL 412 V S L G + + +RET++ Q+ K +FEER+Q + R K ++ Sbjct: 254 VSSGELRGLCAAPREEKERETEAAQMEHQKERNSFEERIQALEEDLREKEREI 306 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,598,014 Number of Sequences: 237096 Number of extensions: 1896253 Number of successful extensions: 5767 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 5408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5766 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -