BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0215 (782 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 33 0.21 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 33 0.21 At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containi... 31 0.65 At5g35160.1 68418.m04167 endomembrane protein 70, putative p76, ... 31 0.86 At5g27230.1 68418.m03248 expressed protein ; expression support... 29 3.5 At5g40200.1 68418.m04878 DegP protease, putative contains simila... 28 6.1 At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly... 28 8.0 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 33.1 bits (72), Expect = 0.21 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = -2 Query: 430 KHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHTRKTGSLVERFKVLS 272 K R + R + + AL N+DVE +E+ L+E T G ER+ VLS Sbjct: 828 KMLREFSKRKDDGRNKRMEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 33.1 bits (72), Expect = 0.21 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = -2 Query: 430 KHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHTRKTGSLVERFKVLS 272 K R + R + + AL N+DVE +E+ L+E T G ER+ VLS Sbjct: 828 KMLREFSKRKDDGRNKRMEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containing protein contains similarity to 67kD chloroplastic RNA-binding protein, P67.1 [Raphanus sativus] GI:9755886; contains Pfam profile PF01535: PPR repeat Length = 711 Score = 31.5 bits (68), Expect = 0.65 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +3 Query: 150 KAVEEFLKMYRTGFMPKNLEFSVF---YDKMRDEAIALSIYSITLRT 281 KA+E F +MY+TG MP + +S Y K LS+Y + T Sbjct: 239 KAIEWFERMYKTGLMPDEVTYSAILDVYSKSGKVEEVLSLYERAVAT 285 >At5g35160.1 68418.m04167 endomembrane protein 70, putative p76, Homo sapiens, EMBL:HSU81006 Length = 627 Score = 31.1 bits (67), Expect = 0.86 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = -3 Query: 588 LFFIIV*NGVRIIGFVNEVVVFLVNAILAAAS-GLMRPSCIFVT*IFCSTSIFINILGYT 412 L ++V +GV+I+G ++F ++ AS G + +F I + ++++ + Sbjct: 326 LLCVMVGDGVQILGMAVVTILFAALGFMSPASRGTLITGMLFFYMILGIAAGYVSVRLWR 385 Query: 411 SYGAGTTKPWQSERWITA 358 + G G + W S W A Sbjct: 386 TIGCGEHRGWMSVAWKAA 403 >At5g27230.1 68418.m03248 expressed protein ; expression supported by MPSS Length = 948 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +3 Query: 9 VDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLK 173 V A+ +EK++K L D S E+ K KD+D+E + K+ VE+ K Sbjct: 69 VKALELEKKEKELCLI-DESMKAKQSEFEKKEKDFDLEQKAEVEKRKREVEQLEK 122 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 75 NTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFL 170 N +DEY K DYD + +D T K+A + L Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDIL 573 >At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly identical to GI:9957293; contains Pfam profile: PF01397 terpene synthase family Length = 591 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +3 Query: 27 EKQKKILSFFQD--VSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLKMYRTGFMPK 200 EK +K+L+ Q + QL D+ K+G Y E +DN ++ + + Sbjct: 82 EKVRKMLNDEQKTYLDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQESDLHAT 141 Query: 201 NLEFSVF 221 LEF +F Sbjct: 142 ALEFRLF 148 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,690,179 Number of Sequences: 28952 Number of extensions: 307844 Number of successful extensions: 812 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -