BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0208 (596 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 4.3 AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. 23 5.7 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 5.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.5 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 9.9 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 23 9.9 AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. 23 9.9 AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. 23 9.9 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 4.3 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 430 PPGSVLEP-DHAGVLNGD 380 PPGS+L+P D A V+ G+ Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109 >AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. Length = 56 Score = 23.4 bits (48), Expect = 5.7 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 4/24 (16%) Frame = +3 Query: 405 SGSRTLP----GGEFDWGGTSVKE 464 +G+RT+P GG F GGT +K+ Sbjct: 21 TGARTVPRVFIGGNFVGGGTDIKK 44 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 451 VPPQSNSPPGSVLEPD 404 +PP SNS P S PD Sbjct: 868 MPPSSNSSPSSYPSPD 883 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 7.5 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +2 Query: 38 PNASSSN**RA*MD*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 187 P AS S R + +SH P ++ T LG SAG E+D++ Sbjct: 2416 PVASLSEGFRKALQIYNSHVPDIVGVLNNHFMTALGRSAGDVQSYEIDAN 2465 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.6 bits (46), Expect = 9.9 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = +3 Query: 57 ISDAHEWINEIPTVPIYYLAKPQP 128 +SD E ++ +P++P+ +P P Sbjct: 354 VSDRSESVSPVPSLPVRSSPEPSP 377 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 22.6 bits (46), Expect = 9.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 410 TGSRGSFKRRRAFPPRHHSARL 345 TGS GS + AFP H SA + Sbjct: 124 TGSAGSSTQIAAFPLDHSSAAI 145 >AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 300 LPPNRVSNETMKVVVFSDDRAKRSPTYATP 211 +PP R T V +FS++R + Y P Sbjct: 170 VPPQRFRETTGMVRIFSNERILITQEYCEP 199 >AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. Length = 215 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 300 LPPNRVSNETMKVVVFSDDRAKRSPTYATP 211 +PP R T V +FS++R + Y P Sbjct: 176 VPPQRFRETTGMVRIFSNERILITQEYCEP 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,867 Number of Sequences: 2352 Number of extensions: 14330 Number of successful extensions: 32 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -