BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0207 (698 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes ... 63 6e-09 UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: ... 48 2e-04 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 43 0.006 UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;... 42 0.019 UniRef50_Q6Z8F1 Cluster: Putative uncharacterized protein P0459B... 37 0.41 UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|... 36 0.96 UniRef50_A7HQK3 Cluster: Cytochrome c oxidase subunit II; n=1; P... 36 1.3 UniRef50_Q8BL71 Cluster: Adult male corpora quadrigemina cDNA, R... 33 5.1 UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; ... 33 6.7 UniRef50_A1VP16 Cluster: Peptidase C14, caspase catalytic subuni... 33 8.9 UniRef50_Q6LFJ9 Cluster: Coatomer alpha subunit, putative; n=3; ... 33 8.9 UniRef50_A2D9Z7 Cluster: Putative uncharacterized protein; n=1; ... 33 8.9 UniRef50_Q8WXI7 Cluster: Mucin-16; n=23; cellular organisms|Rep:... 33 8.9 >UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes scapularis|Rep: Putative secreted protein - Ixodes scapularis (Black-legged tick) (Deer tick) Length = 65 Score = 63.3 bits (147), Expect = 6e-09 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = +1 Query: 58 PY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSDGMSAFIRSKPI 216 P G+TANGS+ Q WFLRS+ TWITV ILELIHA+ AFIR + I Sbjct: 2 PKQGETANGSLNQLWFLRSFLPTWITVAILELIHAVSPKPLGATGAFIRPRSI 54 >UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: LRRG00114 - Rattus norvegicus (Rat) Length = 223 Score = 48.0 bits (109), Expect = 2e-04 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 437 LLPSLDVVAVSQAPSPESNPDSP 369 LLPSLDVVAVSQAPSPE NPDSP Sbjct: 167 LLPSLDVVAVSQAPSPELNPDSP 189 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 43.2 bits (97), Expect = 0.006 Identities = 37/101 (36%), Positives = 48/101 (47%) Frame = -1 Query: 626 LTATILVYXXXXXXXXXXXTRLPSNCSSLKYLKCTHSDYGPRKSPVSLFFVTTSRAGSG* 447 LTATIL+Y TRL K L HS+Y + P ++ S Sbjct: 314 LTATILIYAIGAGITAAAGTRLALQLIFGKVLSSHHSNYKTKIWP----YIVIS------ 363 Query: 446 FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 324 L L++ A+SQAPSPESN +SPLPV M+ I+S Sbjct: 364 -CHYLSYLEL-AISQAPSPESNSNSPLPVKAMLGQYPNIKS 402 >UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein; n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein - Gallus gallus Length = 508 Score = 41.5 bits (93), Expect = 0.019 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +3 Query: 123 YLDNCGNSRANTCNQNSDQ*WDECFY*IKTN 215 YLDNCGNSRANTC + D C Y KTN Sbjct: 468 YLDNCGNSRANTCRRAPTS-GDACIYQTKTN 497 Score = 33.5 bits (73), Expect = 5.1 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +1 Query: 1 PASSYMLVSKIK-PCMSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 177 PASS L ++ C+S Y +TANGS+ Q WFL S ++ + R Sbjct: 426 PASSICLSQRLSHACLSTHGRY-SETANGSLNQLWFLWSLPSRYLDNCGNSRANTCRRAP 484 Query: 178 SDGMSAFIRSKPIDGGP 228 + G + ++K G P Sbjct: 485 TSGDACIYQTKTNPGSP 501 >UniRef50_Q6Z8F1 Cluster: Putative uncharacterized protein P0459B01.16; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein P0459B01.16 - Oryza sativa subsp. japonica (Rice) Length = 172 Score = 37.1 bits (82), Expect = 0.41 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 2 LPVVICLSQRLSHACLS 52 LPVVICLSQRLSHAC S Sbjct: 154 LPVVICLSQRLSHACAS 170 >UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|Rep: Novel protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 118 Score = 35.9 bits (79), Expect = 0.96 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 309 MSALSTFDGSFCDYHG 356 MSALSTFDG+FC YHG Sbjct: 1 MSALSTFDGTFCAYHG 16 >UniRef50_A7HQK3 Cluster: Cytochrome c oxidase subunit II; n=1; Parvibaculum lavamentivorans DS-1|Rep: Cytochrome c oxidase subunit II - Parvibaculum lavamentivorans DS-1 Length = 394 Score = 35.5 bits (78), Expect = 1.3 Identities = 25/67 (37%), Positives = 32/67 (47%) Frame = -3 Query: 558 LQLFLVKIFKVYSFRLRAS*ESRIVIFRHYLPCREWVICAPAAFLGCGSRFSGSLSGIEP 379 L L L ++F+V F S +I + R R ICA AA GC SG LS ++P Sbjct: 140 LDLRLDRVFRVVGFAHDTSPIRKITLLRRGPFRRAAAICAGAALSGC----SGDLSALDP 195 Query: 378 *FPVTRD 358 P RD Sbjct: 196 AGPAARD 202 >UniRef50_Q8BL71 Cluster: Adult male corpora quadrigemina cDNA, RIKEN full-length enriched library, clone:B230353G19 product:weakly similar to GROUP III SECRETED PHOSPHOLIPASE A2; n=1; Mus musculus|Rep: Adult male corpora quadrigemina cDNA, RIKEN full-length enriched library, clone:B230353G19 product:weakly similar to GROUP III SECRETED PHOSPHOLIPASE A2 - Mus musculus (Mouse) Length = 218 Score = 33.5 bits (73), Expect = 5.1 Identities = 20/78 (25%), Positives = 28/78 (35%) Frame = +2 Query: 200 LDQNQSTEGLASEVVNFDDLDNFCRSHGQVPATHLSNVCLINFRW*FLRLPWLSRVTGNQ 379 L N ++ D D CR++G P HL N W + S Q Sbjct: 58 LQYNYGIRNFRFHTISHCDCDARCRAYGSTPLAHLRPRTYYNASW---KAEATSYTPSPQ 114 Query: 380 GSIPEREPEKRLPHPRKA 433 P + P+KR P +A Sbjct: 115 SPAPSKHPQKRGPQQTQA 132 >UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; Roseovarius sp. HTCC2601|Rep: Putative uncharacterized protein - Roseovarius sp. HTCC2601 Length = 507 Score = 33.1 bits (72), Expect = 6.7 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 115 YSVTWITVVILELIHAIRTLTSDGMSAFIRSKPIDGGPRV 234 YS T + VV+ EL+ T+ SD +A I + P+DG R+ Sbjct: 139 YSATSMAVVLSELVVDDETIPSDNAAAQISAGPVDGETRI 178 >UniRef50_A1VP16 Cluster: Peptidase C14, caspase catalytic subunit p20; n=1; Polaromonas naphthalenivorans CJ2|Rep: Peptidase C14, caspase catalytic subunit p20 - Polaromonas naphthalenivorans (strain CJ2) Length = 562 Score = 32.7 bits (71), Expect = 8.9 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -3 Query: 690 VSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWS 592 V+ PR+R D AA + NY L NR+N+ + W+ Sbjct: 163 VNAPPRVRAADPAAVQANY-LANRSNYEVSQWT 194 >UniRef50_Q6LFJ9 Cluster: Coatomer alpha subunit, putative; n=3; Plasmodium|Rep: Coatomer alpha subunit, putative - Plasmodium falciparum (isolate 3D7) Length = 1537 Score = 32.7 bits (71), Expect = 8.9 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -3 Query: 648 HKCNYELF--NRNNFSIRYWSWNYRGCWHQIALQ--LFLVKIFKVYSFRLRAS*ESRIVI 481 H+ N +L N + +IR W N R C H + F + FKV S + A +S +VI Sbjct: 323 HRTNDDLLLSNSEDHTIRIWDINKRSCIHTFRRENDRFWILSFKVNSKLIAAGHDSGMVI 382 Query: 480 FRHY 469 F+ + Sbjct: 383 FKFH 386 >UniRef50_A2D9Z7 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 872 Score = 32.7 bits (71), Expect = 8.9 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 434 LPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES**GRHLKD 300 +PSL V++SQ P+ P +PLP +++E E G + D Sbjct: 67 IPSLPPVSISQTIKPQIIPQNPLPTMNHIISEPLDEPASGEEMAD 111 >UniRef50_Q8WXI7 Cluster: Mucin-16; n=23; cellular organisms|Rep: Mucin-16 - Homo sapiens (Human) Length = 22152 Score = 32.7 bits (71), Expect = 8.9 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = -1 Query: 500 KSPVSLFFVTT---SRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVA 342 ++P + ++TT SG F+ + PS+ + + SPES P SPLPVT ++ + Sbjct: 5614 RTPGDVSWMTTPPVEETSSG-FSLMSPSMTSPSPVSSTSPESIPSSPLPVTALLTS 5668 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,979,114 Number of Sequences: 1657284 Number of extensions: 13976916 Number of successful extensions: 35622 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 34166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35608 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -