BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0207 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 31 0.21 SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||M... 28 1.1 SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos... 27 2.0 SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 comple... 27 2.6 SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk... 26 6.0 SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ... 25 7.9 SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual 25 7.9 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 30.7 bits (66), Expect = 0.21 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +2 Query: 230 ASEVVNFDDLDNFCRSHGQVPATHLSNVCLINFRW*F---LRLPWLSRVTGNQGSIPERE 400 + E+++F + G + L C+IN W LRL +L + NQ S E++ Sbjct: 243 SKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEEQK 302 Query: 401 PEKRLP 418 EKR+P Sbjct: 303 QEKRVP 308 >SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1258 Score = 28.3 bits (60), Expect = 1.1 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -3 Query: 636 YELFNRNNFSI--RYWSWNYRGCWHQIALQLFLVKIF 532 Y+L R+ F R+WSW G +H + L L + +F Sbjct: 1035 YQLGQRSEFFNLKRFWSWITNGFYHSLLLFLCSIAVF 1071 >SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 27.5 bits (58), Expect = 2.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 439 RANYPLPAREVVTKNNDT 492 +AN P+P EVVT+NN T Sbjct: 199 KANIPVPTSEVVTENNVT 216 >SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 442 Score = 27.1 bits (57), Expect = 2.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -1 Query: 290 VLDHAICKSYPDHQN*RLRTRGPPSIGFDLIKALIP 183 ++D K Y H + L + PS GF +I++L+P Sbjct: 391 LIDQGYIKGYIIHASSTLVLKKDPSFGFSVIESLMP 426 >SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.8 bits (54), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 427 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 329 P MW P N+ + YP +PW S+ LPS Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267 >SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 425 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 324 L ++ S+ P + PD P T+ V+ TT+E+ Sbjct: 422 LGLINTSEINQPANLPDEPTAETSNPVSATTVEA 455 >SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual Length = 478 Score = 25.4 bits (53), Expect = 7.9 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -3 Query: 474 HYLPCREWVICAPA 433 HY+PC+ W++ P+ Sbjct: 455 HYIPCQSWLVWYPS 468 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,820,883 Number of Sequences: 5004 Number of extensions: 56184 Number of successful extensions: 122 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -