BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0206 (575 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 52 4e-07 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 43 2e-04 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 36 0.031 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.072 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) 30 1.2 SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28) 27 8.3 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 51.6 bits (118), Expect = 4e-07 Identities = 28/54 (51%), Positives = 33/54 (61%), Gaps = 3/54 (5%) Frame = -3 Query: 570 WPPSCCH--ERPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 W P + E+PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 71 WLPQASYPCEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 51.6 bits (118), Expect = 4e-07 Identities = 30/57 (52%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGFMVGVTRSSPPFKV 379 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF +R+S FKV Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 51.2 bits (117), Expect = 6e-07 Identities = 26/46 (56%), Positives = 31/46 (67%), Gaps = 1/46 (2%) Frame = -3 Query: 552 HERPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +E+PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 122 YEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -3 Query: 549 ERPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 E+PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 41 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 85 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -3 Query: 549 ERPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 E+PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 38 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -3 Query: 549 ERPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 E+PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Frame = -3 Query: 549 ERPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 E+PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTSNSHSLSGF 83 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/45 (55%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = -3 Query: 549 ERPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 E+PTPF+ S ER L FGSS ASSA Q WPT + H +SGF Sbjct: 58 EQPTPFVGSDERRLWHLNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/44 (54%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L +GSS ASSAYQ WPT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 46.0 bits (104), Expect = 2e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 193 NRYGPPSGFPLTST*PGIVHHLSGPSICA 107 NRY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/44 (54%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQISGF 418 +PTPF+ S ER L FGSS ASSAYQ PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 549 ERPTPFMVSHERFL-AP*TTFGSSHSASSAYQNWPTWHRHQISGF 418 E+PTPF+ S ER L P FGSS ASS YQN PT R GF Sbjct: 58 EQPTPFVGSDERRLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGF 102 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -1 Query: 194 ESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 105 ESLR+S RVS F L RHSSPSFGSQ + S Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.9 bits (94), Expect = 4e-04 Identities = 22/41 (53%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPTWHRHQI 427 +PTPF+ S ER L FGSS ASSAYQ WPT + H + Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSL 42 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/35 (60%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWPT 445 +PTPF+ S ER L FGSS ASSAYQ WPT Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 35.5 bits (78), Expect = 0.031 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 482 DEPNV-V*GAKKRSWDTMKGVGRS*QQDGGHG 574 DEPN + +RS D KGVG S QQDGGHG Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHG 34 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.031 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 482 DEPNV-V*GAKKRSWDTMKGVGRS*QQDGGHG 574 DEPN + +RS D KGVG S QQDGGHG Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHG 34 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.031 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 482 DEPNV-V*GAKKRSWDTMKGVGRS*QQDGGHG 574 DEPN + +RS D KGVG S QQDGGHG Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHG 34 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 34.7 bits (76), Expect = 0.055 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +3 Query: 507 PKNAHGTP*KALVAHDSRTVAME 575 P +AH TP K LVA DSRTVAME Sbjct: 7 PLDAHQTPQKVLVALDSRTVAME 29 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 34.3 bits (75), Expect = 0.072 Identities = 20/34 (58%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 546 RPTPFMVSHERFLAP*T-TFGSSHSASSAYQNWP 448 +PTPF+ S ER L FGSS ASSAYQN P Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQNGP 35 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 193 NRYGPPSGFPLTST*PGIVHH 131 NRY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.22 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 243 ISLSPLYPVPTIDLHVR 193 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) Length = 128 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 4/54 (7%) Frame = +1 Query: 61 LPRRLVSNQ*MKARSEHKC----WDPKDGELCLVRSKSGETLMEDRSDSDVQID 210 L RR VSN + +++H+ + +DG+ V++K G++L++ D+DV ++ Sbjct: 29 LARRYVSNGKEQTKAKHETVSITFVDRDGDRQTVKAKVGDSLLDVAKDNDVDLE 82 >SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28) Length = 307 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 139 VHHLSGPSICAQSAPSFTDWKRDASGVRKSR 47 V L+ S+C Q APSF + K+ AS VR ++ Sbjct: 183 VRKLAKISLCDQYAPSFKEKKKMASEVRVAK 213 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,590,837 Number of Sequences: 59808 Number of extensions: 441706 Number of successful extensions: 943 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -