BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0204 (412 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_1002 + 10171942-10172859,10173369-10173452 28 3.3 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 27 4.4 12_02_0512 - 19889845-19890468,19890958-19891413,19891727-19892215 27 5.8 >08_01_1002 + 10171942-10172859,10173369-10173452 Length = 333 Score = 27.9 bits (59), Expect = 3.3 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 5/68 (7%) Frame = -1 Query: 217 RASRPKSLILMN--LDNFCRSHGQVPATHLSNVCLINF--RW*FLRLPWL-SRVTGNQGS 53 RA + SL L +DN CR G++P + +N+ + F FL WL SRV + S Sbjct: 242 RAPKLHSLTLWTPAVDNGCRVAGELPLLNAANISVDAFLGTEDFLDTLWLVSRVKVLKFS 301 Query: 52 IPEREPEK 29 + +RE K Sbjct: 302 VRDRENRK 309 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 27.5 bits (58), Expect = 4.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 7 PSLDVVAVSQAPSPESNPDSPLP 75 P LD ++Q PSP +NP P P Sbjct: 55 PPLDEETLAQFPSPPTNPSPPPP 77 >12_02_0512 - 19889845-19890468,19890958-19891413,19891727-19892215 Length = 522 Score = 27.1 bits (57), Expect = 5.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 209 RGPPSIGFDLIKALIHHWSE 268 R PP G DL+ LI HW + Sbjct: 277 RAPPENGGDLVDVLIGHWKK 296 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,332,558 Number of Sequences: 37544 Number of extensions: 217472 Number of successful extensions: 557 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 730630428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -