BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0201 (753 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 31 0.98 02_05_0315 - 27822379-27823899 30 2.3 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 29 4.0 10_07_0135 + 13308839-13308899,13310146-13310495,13310574-133107... 29 5.2 08_02_0526 + 18184146-18184168,18184247-18184438,18184846-181849... 29 5.2 08_01_1002 + 10171942-10172859,10173369-10173452 28 9.2 01_05_0005 - 16886553-16886946,16887079-16887404 28 9.2 >06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 Length = 717 Score = 31.1 bits (67), Expect = 0.98 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 Query: 224 REPEKRLPHPRRQQARKLPTPGTGGSD 304 R E + P PRRQQ + P P GG D Sbjct: 495 RHFEDKCPKPRRQQGQAPPRPNNGGKD 521 >02_05_0315 - 27822379-27823899 Length = 506 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = -2 Query: 293 PCREWVICAPAAFLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIE 156 PCR W I P A LD V V + P P L T+++ E IE Sbjct: 451 PCR-WKIADPDALLDTVVVLKKPDPGLWDRVILTDLTLMIYEQRIE 495 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 239 RLPHPRRQQARKLPTPGTGGSD 304 + P PRRQQ + P P GG D Sbjct: 664 KCPKPRRQQGQAPPRPNNGGKD 685 >10_07_0135 + 13308839-13308899,13310146-13310495,13310574-13310709, 13310806-13310942,13311041-13311164,13313393-13313871 Length = 428 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 188 SRVTGNQGSIPEREPEKRLPHPRRQQARKLPTPGTG 295 +R + GS+P R P + P PRR A P P G Sbjct: 382 TRRRSSSGSVP-RSPMRMQPSPRRLSASASPLPAAG 416 >08_02_0526 + 18184146-18184168,18184247-18184438,18184846-18184954, 18185071-18185220,18185973-18186136,18186273-18186359, 18187083-18187137,18187911-18188333 Length = 400 Score = 28.7 bits (61), Expect = 5.2 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 212 SIPEREPEKRLPHPRRQQARKLPTPGT-GGSDEK*RYGTLTRPRNRNEYTLNILTR 376 S P ++ + R P PRR+ + P P G S + R L P N N Y + TR Sbjct: 39 SPPPKKSDSRSPPPRRRSTSRSPRPRRHGRSRSRSRDDDLRNPGN-NLYVTGLSTR 93 >08_01_1002 + 10171942-10172859,10173369-10173452 Length = 333 Score = 27.9 bits (59), Expect = 9.2 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 5/68 (7%) Frame = +2 Query: 50 RASRPKSLILMN--LDNFCRSHGQVPATHLSNVCLINF--RW*FLRLPWL-SRVTGNQGS 214 RA + SL L +DN CR G++P + +N+ + F FL WL SRV + S Sbjct: 242 RAPKLHSLTLWTPAVDNGCRVAGELPLLNAANISVDAFLGTEDFLDTLWLVSRVKVLKFS 301 Query: 215 IPEREPEK 238 + +RE K Sbjct: 302 VRDRENRK 309 >01_05_0005 - 16886553-16886946,16887079-16887404 Length = 239 Score = 27.9 bits (59), Expect = 9.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 451 RNNFSIRYWSWNYRGC 404 R+N S RYW W GC Sbjct: 90 RSNSSFRYWRWQPHGC 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,720,897 Number of Sequences: 37544 Number of extensions: 452147 Number of successful extensions: 1178 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1178 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2004270760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -