BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0199 (436 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC110806-1|AAI10807.1| 234|Homo sapiens hypothetical LOC441177 ... 32 0.74 AK094116-1|BAC04291.1| 234|Homo sapiens protein ( Homo sapiens ... 32 0.74 BC146790-1|AAI46791.1| 1460|Homo sapiens centrosomal protein 170... 31 1.7 BC078155-1|AAH78155.1| 417|Homo sapiens CEP170 protein protein. 31 1.7 BC025353-1|AAH25353.1| 599|Homo sapiens Similar to DKFZP434N178... 31 1.7 BC014590-1|AAH14590.2| 293|Homo sapiens CEP170L protein protein. 31 1.7 AL606534-4|CAI12944.1| 1584|Homo sapiens centrosomal protein 170... 31 1.7 AL606534-3|CAI12943.1| 1486|Homo sapiens centrosomal protein 170... 31 1.7 AL606534-2|CAI12945.1| 1460|Homo sapiens centrosomal protein 170... 31 1.7 AL606534-1|CAI12942.1| 1557|Homo sapiens centrosomal protein 170... 31 1.7 AB033062-1|BAA86550.2| 1840|Homo sapiens KIAA1236 protein protein. 31 1.7 AB022659-1|BAA83380.1| 1460|Homo sapiens KARP-1-binding protein ... 31 1.7 AB022658-1|BAA83379.1| 1486|Homo sapiens KARP-1-binding protein ... 31 1.7 AB022657-1|BAA83378.1| 1584|Homo sapiens KARP-1-binding protein ... 31 1.7 AB007939-1|BAA32315.2| 1472|Homo sapiens KIAA0470 protein protein. 31 1.7 >BC110806-1|AAI10807.1| 234|Homo sapiens hypothetical LOC441177 protein. Length = 234 Score = 32.3 bits (70), Expect = 0.74 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -2 Query: 228 RRHPSAARGLPPSTGKRPRSRRTWPGVVATRKRNLPNTTSP 106 RR + ARG PP+ G+ P RR+ G T KR P SP Sbjct: 176 RRDVAGARGAPPAWGQAPSPRRSVGGPQKTLKR--PKACSP 214 >AK094116-1|BAC04291.1| 234|Homo sapiens protein ( Homo sapiens cDNA FLJ36797 fis, clone ADRGL2006846. ). Length = 234 Score = 32.3 bits (70), Expect = 0.74 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -2 Query: 228 RRHPSAARGLPPSTGKRPRSRRTWPGVVATRKRNLPNTTSP 106 RR + ARG PP+ G+ P RR+ G T KR P SP Sbjct: 176 RRDVAGARGAPPAWGQAPSPRRSVGGPQKTLKR--PKACSP 214 >BC146790-1|AAI46791.1| 1460|Homo sapiens centrosomal protein 170kDa protein. Length = 1460 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 1249 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 1289 >BC078155-1|AAH78155.1| 417|Homo sapiens CEP170 protein protein. Length = 417 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 257 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 297 >BC025353-1|AAH25353.1| 599|Homo sapiens Similar to DKFZP434N178 protein protein. Length = 599 Score = 31.1 bits (67), Expect = 1.7 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -2 Query: 234 SFRRHPSAARGLPPSTGKRPRSRRTWPGVVATRKRNLPNTTSP 106 S + P++ +GL P G PR P TRK +L +SP Sbjct: 52 SLKASPTSKKGLAPKAGFLPRPSGAAPPAPPTRKSSLEQRSSP 94 >BC014590-1|AAH14590.2| 293|Homo sapiens CEP170L protein protein. Length = 293 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 82 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 122 >AL606534-4|CAI12944.1| 1584|Homo sapiens centrosomal protein 170kDa protein. Length = 1584 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 1373 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 1413 >AL606534-3|CAI12943.1| 1486|Homo sapiens centrosomal protein 170kDa protein. Length = 1486 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 1275 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 1315 >AL606534-2|CAI12945.1| 1460|Homo sapiens centrosomal protein 170kDa protein. Length = 1460 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 1249 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 1289 >AL606534-1|CAI12942.1| 1557|Homo sapiens centrosomal protein 170kDa protein. Length = 1557 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 1346 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 1386 >AB033062-1|BAA86550.2| 1840|Homo sapiens KIAA1236 protein protein. Length = 1840 Score = 31.1 bits (67), Expect = 1.7 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -2 Query: 234 SFRRHPSAARGLPPSTGKRPRSRRTWPGVVATRKRNLPNTTSP 106 S + P++ +GL P G PR P TRK +L +SP Sbjct: 1293 SLKASPTSKKGLAPKAGFLPRPSGAAPPAPPTRKSSLEQRSSP 1335 >AB022659-1|BAA83380.1| 1460|Homo sapiens KARP-1-binding protein 3 protein. Length = 1460 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 1249 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 1289 >AB022658-1|BAA83379.1| 1486|Homo sapiens KARP-1-binding protein 2 (KAB2) protein. Length = 1486 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 1275 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 1315 >AB022657-1|BAA83378.1| 1584|Homo sapiens KARP-1-binding protein 1 (KAB1) protein. Length = 1584 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 1373 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 1413 >AB007939-1|BAA32315.2| 1472|Homo sapiens KIAA0470 protein protein. Length = 1472 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 190 YGKTPPFKTNLARSRRDEKAEPPEH-HISRYRLKQRDSVLG 71 + KTP + R + AEPP+H I+R R RD V+G Sbjct: 1261 HSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMG 1301 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,830,292 Number of Sequences: 237096 Number of extensions: 1566623 Number of successful extensions: 3648 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3648 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3487985734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -