BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0197 (760 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT012669-1|AAT08475.1| 46|Drosophila melanogaster LD48059p pro... 64 3e-10 EF120977-1|ABO93155.1| 1349|Drosophila melanogaster misfire prot... 30 3.9 L77907-1|AAC37264.1| 1883|Drosophila melanogaster chromodomain-h... 29 9.1 EF120981-1|ABO93159.1| 637|Drosophila melanogaster misfire prot... 29 9.1 EF120979-1|ABO93157.1| 1396|Drosophila melanogaster misfire prot... 29 9.1 EF120978-1|ABO93156.1| 839|Drosophila melanogaster misfire prot... 29 9.1 EF120976-1|ABO93154.1| 1437|Drosophila melanogaster misfire prot... 29 9.1 EF120975-1|ABO93153.1| 1659|Drosophila melanogaster misfire prot... 29 9.1 BT011071-1|AAR82736.1| 1645|Drosophila melanogaster SD21488p pro... 29 9.1 AY095050-1|AAM11378.1| 1101|Drosophila melanogaster LD39323p pro... 29 9.1 AE014296-1535|AAF50355.1| 1782|Drosophila melanogaster CG5747-PA... 29 9.1 AE014134-528|AAF51170.1| 1883|Drosophila melanogaster CG3733-PA ... 29 9.1 >BT012669-1|AAT08475.1| 46|Drosophila melanogaster LD48059p protein. Length = 46 Score = 63.7 bits (148), Expect = 3e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +3 Query: 138 EHKCWDPKDGELCLVRSKSGETLMEDRSDSDVQIDRRN 251 EH C DPKDGEL L+R KSGETLMEDR+ SDVQID +N Sbjct: 9 EHICCDPKDGELYLIRLKSGETLMEDRNSSDVQIDCQN 46 >EF120977-1|ABO93155.1| 1349|Drosophila melanogaster misfire protein. Length = 1349 Score = 29.9 bits (64), Expect = 3.9 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 607 SRNPLRSVQRLTCRSNQP*KWMALKR 684 SRNPLR +QRL + P KW+ + R Sbjct: 479 SRNPLRKLQRLKYLTPPPLKWVPIAR 504 >L77907-1|AAC37264.1| 1883|Drosophila melanogaster chromodomain-helicase-DNA-bindingprotein protein. Length = 1883 Score = 28.7 bits (61), Expect = 9.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 171 VHHLSGPSICAQSAPSFTDWKRD 103 +HHL GP +C + T W+R+ Sbjct: 573 IHHLYGPFLCVVPLSTMTAWQRE 595 >EF120981-1|ABO93159.1| 637|Drosophila melanogaster misfire protein. Length = 637 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 607 SRNPLRSVQRLTCRSNQP*KWMALKR 684 S+NPLR +QRL + P KW+ + R Sbjct: 477 SKNPLRKLQRLKYLTPPPLKWVPIAR 502 >EF120979-1|ABO93157.1| 1396|Drosophila melanogaster misfire protein. Length = 1396 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 607 SRNPLRSVQRLTCRSNQP*KWMALKR 684 S+NPLR +QRL + P KW+ + R Sbjct: 567 SKNPLRKLQRLKYLTPPPLKWVPIAR 592 >EF120978-1|ABO93156.1| 839|Drosophila melanogaster misfire protein. Length = 839 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 607 SRNPLRSVQRLTCRSNQP*KWMALKR 684 S+NPLR +QRL + P KW+ + R Sbjct: 28 SKNPLRKLQRLKYLTPPPLKWVPIAR 53 >EF120976-1|ABO93154.1| 1437|Drosophila melanogaster misfire protein. Length = 1437 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 607 SRNPLRSVQRLTCRSNQP*KWMALKR 684 S+NPLR +QRL + P KW+ + R Sbjct: 567 SKNPLRKLQRLKYLTPPPLKWVPIAR 592 >EF120975-1|ABO93153.1| 1659|Drosophila melanogaster misfire protein. Length = 1659 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 607 SRNPLRSVQRLTCRSNQP*KWMALKR 684 S+NPLR +QRL + P KW+ + R Sbjct: 789 SKNPLRKLQRLKYLTPPPLKWVPIAR 814 >BT011071-1|AAR82736.1| 1645|Drosophila melanogaster SD21488p protein. Length = 1645 Score = 28.7 bits (61), Expect = 9.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 171 VHHLSGPSICAQSAPSFTDWKRD 103 +HHL GP +C + T W+R+ Sbjct: 573 IHHLYGPFLCVVPLSTMTAWQRE 595 >AY095050-1|AAM11378.1| 1101|Drosophila melanogaster LD39323p protein. Length = 1101 Score = 28.7 bits (61), Expect = 9.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 171 VHHLSGPSICAQSAPSFTDWKRD 103 +HHL GP +C + T W+R+ Sbjct: 41 IHHLYGPFLCVVPLSTMTAWQRE 63 >AE014296-1535|AAF50355.1| 1782|Drosophila melanogaster CG5747-PA protein. Length = 1782 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 607 SRNPLRSVQRLTCRSNQP*KWMALKR 684 S+NPLR +QRL + P KW+ + R Sbjct: 751 SKNPLRKLQRLKYLTPPPLKWVPIAR 776 >AE014134-528|AAF51170.1| 1883|Drosophila melanogaster CG3733-PA protein. Length = 1883 Score = 28.7 bits (61), Expect = 9.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 171 VHHLSGPSICAQSAPSFTDWKRD 103 +HHL GP +C + T W+R+ Sbjct: 573 IHHLYGPFLCVVPLSTMTAWQRE 595 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,405,194 Number of Sequences: 53049 Number of extensions: 799153 Number of successful extensions: 1665 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1665 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3478915869 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -