BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0194 (647 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical p... 28 6.6 AL110487-1|CAB54424.1| 610|Caenorhabditis elegans Hypothetical ... 27 8.7 >Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical protein Y69H2.14 protein. Length = 338 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 6/38 (15%) Frame = -1 Query: 371 DNCKPQSPARRSFSGLPGPLGQ----GE--HADSFSVA 276 ++C+ +PAR+ G PGP GQ GE H+D+ S A Sbjct: 190 NDCQTCAPARQGAPGPPGPAGQPGQPGEPGHSDTSSTA 227 >AL110487-1|CAB54424.1| 610|Caenorhabditis elegans Hypothetical protein Y39E4B.1 protein. Length = 610 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 397 LLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENM 296 L G+P ++G++ P+ EG++ G ENM Sbjct: 300 LYGVPGVYGVVTLPSGVREGINMFLEGFIRTENM 333 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,602,989 Number of Sequences: 27780 Number of extensions: 305286 Number of successful extensions: 801 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -