BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0193 (616 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL445068-2|CAI22520.1| 366|Homo sapiens protein ( Human DNA seq... 33 1.1 AL050350-5|CAI42513.1| 366|Homo sapiens protein ( Human DNA seq... 33 1.1 AK092858-1|BAC03991.1| 739|Homo sapiens protein ( Homo sapiens ... 31 3.2 DQ427109-1|ABD72605.1| 1048|Homo sapiens OTUD4: OTU domain conta... 30 5.6 BC118653-1|AAI18654.1| 1049|Homo sapiens OTU domain containing 4... 30 5.6 BC118572-1|AAI18573.1| 1049|Homo sapiens OTU domain containing 4... 30 5.6 AL117481-1|CAB55954.1| 319|Homo sapiens hypothetical protein pr... 30 5.6 U77735-1|AAC78506.1| 334|Homo sapiens pim-2 protooncogene homol... 30 7.5 BC112034-1|AAI12035.1| 157|Homo sapiens hypothetical protein LO... 30 7.5 BC093711-1|AAH93711.1| 157|Homo sapiens hypothetical protein LO... 30 7.5 AL133561-1|CAB63715.1| 580|Homo sapiens hypothetical protein pr... 30 7.5 AF282168-1|AAG03039.1| 437|Homo sapiens DRC3 protein. 29 9.9 AF282167-1|AAG03038.1| 437|Homo sapiens DRC3 protein. 29 9.9 >AL445068-2|CAI22520.1| 366|Homo sapiens protein ( Human DNA sequence from clone RP1-71D21 on chromosome 6. ). Length = 366 Score = 32.7 bits (71), Expect = 1.1 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +1 Query: 76 PRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRARPTRYG 207 PR +SR + Y+ R+ P SG TP P C R RP R G Sbjct: 65 PRGASRRQVTYVRSGRRAPPGGGGSG-TPEPGCCAPRGRPRRKG 107 >AL050350-5|CAI42513.1| 366|Homo sapiens protein ( Human DNA sequence from clone RP1-261K5 on chromosome 6q21-22.1 Contains the 3' end of the SLC22A16 gene for solute carrier family ). Length = 366 Score = 32.7 bits (71), Expect = 1.1 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +1 Query: 76 PRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRARPTRYG 207 PR +SR + Y+ R+ P SG TP P C R RP R G Sbjct: 65 PRGASRRQVTYVRSGRRAPPGGGGSG-TPEPGCCAPRGRPRRKG 107 >AK092858-1|BAC03991.1| 739|Homo sapiens protein ( Homo sapiens cDNA FLJ35539 fis, clone SPLEN2002477, weakly similar to Rattus norvegicus (rsec6) mRNA. ). Length = 739 Score = 31.1 bits (67), Expect = 3.2 Identities = 22/53 (41%), Positives = 29/53 (54%) Frame = +1 Query: 19 LHLRLNMTREQLLFTRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCA 177 L LR +++REQ L PSPR S R + + L+P AP AP+ P CA Sbjct: 685 LGLRGDLSREQHLAALPPSPRASRR--VLFSLVP---APALAPASCLPSGSCA 732 >DQ427109-1|ABD72605.1| 1048|Homo sapiens OTUD4: OTU domain containing 4 protein. Length = 1048 Score = 30.3 bits (65), Expect = 5.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 478 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 383 +GP+LV G T +++KAP SW+T+ G Sbjct: 246 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 276 >BC118653-1|AAI18654.1| 1049|Homo sapiens OTU domain containing 4 protein. Length = 1049 Score = 30.3 bits (65), Expect = 5.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 478 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 383 +GP+LV G T +++KAP SW+T+ G Sbjct: 247 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 277 >BC118572-1|AAI18573.1| 1049|Homo sapiens OTU domain containing 4 protein. Length = 1049 Score = 30.3 bits (65), Expect = 5.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 478 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 383 +GP+LV G T +++KAP SW+T+ G Sbjct: 247 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 277 >AL117481-1|CAB55954.1| 319|Homo sapiens hypothetical protein protein. Length = 319 Score = 30.3 bits (65), Expect = 5.6 Identities = 24/59 (40%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +1 Query: 73 SPRQSSRASLEYLLLPPRSAPTEAPS--GLTPRPFCALRRARPTRYGLMIPN*KFSITR 243 SP RAS PPR++PT PS LT P A P+R LM SITR Sbjct: 11 SPMTPPRASPR---TPPRASPTTTPSRASLTRTPSWASPTTTPSRASLMKMESTVSITR 66 >U77735-1|AAC78506.1| 334|Homo sapiens pim-2 protooncogene homolog pim-2h protein. Length = 334 Score = 29.9 bits (64), Expect = 7.5 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +1 Query: 55 LFTRNPSPRQSSRASLEYLLLPP-RSAPTEAPSGLTPRPFCALRRARPTRYGLMI 216 L R +P+ SSR SLE +LL P P E +TP+P L+R RP +GL++ Sbjct: 262 LIRRCLAPKPSSRPSLEEILLDPWMQTPAE---DVTPQP---LQR-RPCPFGLVL 309 >BC112034-1|AAI12035.1| 157|Homo sapiens hypothetical protein LOC284009 protein. Length = 157 Score = 29.9 bits (64), Expect = 7.5 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 56 CSRETLLHVSPPGPRWSICYYHQDLHR-RRLQAGSRPDP 169 C R ++H+ G RW + HR RR GSRP P Sbjct: 40 CGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVP 78 >BC093711-1|AAH93711.1| 157|Homo sapiens hypothetical protein LOC284009 protein. Length = 157 Score = 29.9 bits (64), Expect = 7.5 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 56 CSRETLLHVSPPGPRWSICYYHQDLHR-RRLQAGSRPDP 169 C R ++H+ G RW + HR RR GSRP P Sbjct: 40 CGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVP 78 >AL133561-1|CAB63715.1| 580|Homo sapiens hypothetical protein protein. Length = 580 Score = 29.9 bits (64), Expect = 7.5 Identities = 23/51 (45%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = +1 Query: 61 TRNPSP----RQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRARPTR 201 TR+PS R SRASL PPR++PT P +PR RA PTR Sbjct: 168 TRSPSTASLTRTPSRASLTRW--PPRASPTRTPPRESPR---MSHRASPTR 213 >AF282168-1|AAG03039.1| 437|Homo sapiens DRC3 protein. Length = 437 Score = 29.5 bits (63), Expect = 9.9 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +1 Query: 43 REQLLFTRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPF 171 R++ ++ P+PR S A PPRSAP P L P P+ Sbjct: 393 RDRAAQSQGPAPRNRSSARAR---TPPRSAPGCRPRALAPGPW 432 >AF282167-1|AAG03038.1| 437|Homo sapiens DRC3 protein. Length = 437 Score = 29.5 bits (63), Expect = 9.9 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +1 Query: 43 REQLLFTRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPF 171 R++ ++ P+PR S A PPRSAP P L P P+ Sbjct: 393 RDRAAQSQGPAPRNRSSARAR---TPPRSAPGCRPRALAPGPW 432 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,270,139 Number of Sequences: 237096 Number of extensions: 2236638 Number of successful extensions: 5734 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 5348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5714 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6579110070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -