BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0184 (421 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. 31 2.1 AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type ... 31 2.1 AY750848-1|AAU81930.1| 1032|Homo sapiens RTN3-A1 protein. 30 2.7 AY427821-1|AAR02474.1| 1013|Homo sapiens reticulon 3-A protein. 30 2.7 >BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. Length = 322 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -2 Query: 291 AAGGAKLPSAGLS*TPLRPKPA*PNPARICSLWSPESRE 175 A G P++ + TP P P P PA +CS SPE R+ Sbjct: 56 AQPGTHFPTSNCTPTP--PTPVLPGPASLCSPASPELRQ 92 >AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type containing 12 protein. Length = 210 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -2 Query: 291 AAGGAKLPSAGLS*TPLRPKPA*PNPARICSLWSPESRE 175 A G P++ + TP P P P PA +CS SPE R+ Sbjct: 56 AQPGTHFPTSNCTPTP--PTPVLPGPASLCSPASPELRQ 92 >AY750848-1|AAU81930.1| 1032|Homo sapiens RTN3-A1 protein. Length = 1032 Score = 30.3 bits (65), Expect = 2.7 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = -1 Query: 277 EATIRGIILNASKAEASLAESGKDMLTVEP------RESGGSKQCDFTSRVSHSKRETRR 116 E +GI+ + A +++E D T P ESGGS+ D S+ S +ET Sbjct: 660 ETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNG 719 Query: 115 RSPFG 101 P G Sbjct: 720 SEPLG 724 >AY427821-1|AAR02474.1| 1013|Homo sapiens reticulon 3-A protein. Length = 1013 Score = 30.3 bits (65), Expect = 2.7 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = -1 Query: 277 EATIRGIILNASKAEASLAESGKDMLTVEP------RESGGSKQCDFTSRVSHSKRETRR 116 E +GI+ + A +++E D T P ESGGS+ D S+ S +ET Sbjct: 641 ETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNG 700 Query: 115 RSPFG 101 P G Sbjct: 701 SEPLG 705 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,608,574 Number of Sequences: 237096 Number of extensions: 1230774 Number of successful extensions: 3503 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3503 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3202085264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -