BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0178 (745 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC128392-1|AAI28393.1| 782|Homo sapiens zinc finger protein 786... 31 3.3 BC109245-1|AAI09246.1| 753|Homo sapiens ZNF786 protein protein. 31 3.3 >BC128392-1|AAI28393.1| 782|Homo sapiens zinc finger protein 786 protein. Length = 782 Score = 31.5 bits (68), Expect = 3.3 Identities = 23/69 (33%), Positives = 28/69 (40%) Frame = +3 Query: 492 RAWENHGERRPC*A*L*SGIVRRHERCSISGRSFRAIVAEKPLLSLFHYLLGXAERCAVD 671 RAWE +R S V+RH RC + G+SFR L L +L R Sbjct: 216 RAWEKFNKRAETQMPWSSPRVQRHFRCGVCGKSFRR------KLCLLRHLAAHTGRGPFR 269 Query: 672 NISGRTVFR 698 N G FR Sbjct: 270 NADGEMCFR 278 >BC109245-1|AAI09246.1| 753|Homo sapiens ZNF786 protein protein. Length = 753 Score = 31.5 bits (68), Expect = 3.3 Identities = 23/69 (33%), Positives = 28/69 (40%) Frame = +3 Query: 492 RAWENHGERRPC*A*L*SGIVRRHERCSISGRSFRAIVAEKPLLSLFHYLLGXAERCAVD 671 RAWE +R S V+RH RC + G+SFR L L +L R Sbjct: 187 RAWEKFNKRAETQMPWSSPRVQRHFRCGVCGKSFRR------KLCLLRHLAAHTGRGPFR 240 Query: 672 NISGRTVFR 698 N G FR Sbjct: 241 NADGEMCFR 249 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,580,470 Number of Sequences: 237096 Number of extensions: 2342829 Number of successful extensions: 4818 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4818 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8903143626 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -