Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0176
         (605 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF098501-10|AAC67405.3| 1744|Caenorhabditis elegans Mtm (myotubu...    29   1.9  

>AF098501-10|AAC67405.3| 1744|Caenorhabditis elegans Mtm
            (myotubularin) family protein 5 protein.
          Length = 1744

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 17/63 (26%), Positives = 28/63 (44%)
 Frame = +3

Query: 108  LSFLIDENTFGKCFR*CSSCDDPRISPLTSQYECPQLSLLIITSEF*KPQNRTEIIFYYS 287
            +SFL   +T G        C++ R+    +++  P     I   EF K +NR    FY  
Sbjct: 1363 ISFLAYHSTAGYFRTFIDDCEEKRLQSDANEFYLPDNLATINVWEFIKLRNRVSAAFYNE 1422

Query: 288  MHE 296
            ++E
Sbjct: 1423 LYE 1425


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,539,016
Number of Sequences: 27780
Number of extensions: 251973
Number of successful extensions: 644
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 610
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 644
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1300523034
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)