BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0161 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 1.2 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 2.9 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 24 3.8 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 3.8 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 3.8 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 24 5.0 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 24 5.0 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 8.8 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 23 8.8 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 23 8.8 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 23 8.8 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 23 8.8 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 1.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 136 NSSRTSRRRLQATL 95 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 445 RIRFPSKPDTPRSSEPILIPKLRIQFADFPYL 350 R+R + TP+ +++PKL+ + A P+L Sbjct: 5 RLRLITSFGTPQDKRTMVLPKLKDETAVMPFL 36 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 397 LALRTGACRVWTGSGCGRCRVWSM 468 +++ G V G+ C C VWSM Sbjct: 5 ISVHVGQAGVQIGNPCWDCTVWSM 28 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 461 QTRHRPHPLPVQTRHAPVLRANPYSEVT 378 Q H PH Q +H P + P++ V+ Sbjct: 72 QLHHSPHQYHQQVQHQPQPPSTPFANVS 99 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 461 QTRHRPHPLPVQTRHAPVLRANPYSEVT 378 Q H PH Q +H P + P++ V+ Sbjct: 73 QLHHSPHQYHQQVQHQPQPPSTPFANVS 100 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.8 bits (49), Expect = 5.0 Identities = 19/63 (30%), Positives = 24/63 (38%) Frame = -3 Query: 198 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSNTRF*RRGNDY*NGSAAGSGI 19 F T+ Y N+ A + T G G FRP+ TP N N AG G+ Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPENGYAEEPSNASYPRFIAGPGV 271 Query: 18 GTG 10 G Sbjct: 272 AMG 274 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.8 bits (49), Expect = 5.0 Identities = 19/63 (30%), Positives = 24/63 (38%) Frame = -3 Query: 198 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSNTRF*RRGNDY*NGSAAGSGI 19 F T+ Y N+ A + T G G FRP+ TP N N AG G+ Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPENGYAEEPSNASYPRFIAGPGV 271 Query: 18 GTG 10 G Sbjct: 272 AMG 274 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -2 Query: 295 YEPARHLHVHPSPDFQGPQRVSGHRRKCGA 206 ++ H H + GP +S R CGA Sbjct: 655 HQGQHHAQHHSNGTHHGPSLMSSARESCGA 684 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 258 LIFKVRREYPDTAAN 214 LI K+R EYPD N Sbjct: 47 LISKIREEYPDRIMN 61 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 258 LIFKVRREYPDTAAN 214 LI K+R EYPD N Sbjct: 47 LISKIREEYPDRIMN 61 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 258 LIFKVRREYPDTAAN 214 LI K+R EYPD N Sbjct: 47 LISKIREEYPDRIMN 61 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 258 LIFKVRREYPDTAAN 214 LI K+R EYPD N Sbjct: 47 LISKIREEYPDRIMN 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 731,442 Number of Sequences: 2352 Number of extensions: 15875 Number of successful extensions: 38 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -