BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0157 (758 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 2.5 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 3.4 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 4.4 At5g42370.1 68418.m05159 expressed protein 29 4.4 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 5.9 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.9 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 7.7 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 7.7 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 459 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 364 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +3 Query: 36 SETVSIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 179 ++ S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 37 TKEASLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 246 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 112 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 185 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 75 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 590 RVRIQSET*DDFRECHIKYIQFLRPH 513 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 241 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 143 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 468 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 349 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 468 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 349 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,679,100 Number of Sequences: 28952 Number of extensions: 391969 Number of successful extensions: 1185 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1183 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -