BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0155 (682 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 72 2e-12 BC084581-1|AAH84581.1| 163|Homo sapiens ZNF703 protein protein. 31 5.0 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 72.1 bits (169), Expect = 2e-12 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +3 Query: 285 MIGRADIEGSKGNVAMNAWLPQASYPCGNFSGTSC*K 395 MIGRADIEGSK +VAMNAW PQASYPCGNFS TSC K Sbjct: 1 MIGRADIEGSKSDVAMNAWPPQASYPCGNFSDTSCLK 37 >BC084581-1|AAH84581.1| 163|Homo sapiens ZNF703 protein protein. Length = 163 Score = 30.7 bits (66), Expect = 5.0 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 Query: 480 LLHARFLSSLAGLRTPALFFDRCTAPVKLPAWQCPRTGSRGSFKRR 617 LLH +L L+ + D +P+ L A C +TGS GS R Sbjct: 63 LLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQTGSPGSLSLR 108 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,564,682 Number of Sequences: 237096 Number of extensions: 2434712 Number of successful extensions: 5043 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5043 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7727256732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -