BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0154 (642 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025467-2|AAN65301.1| 505|Caenorhabditis elegans Hypothetical ... 28 4.9 AF025467-1|AAB71039.2| 528|Caenorhabditis elegans Hypothetical ... 28 4.9 U42437-3|AAA83495.1| 297|Caenorhabditis elegans Hypothetical pr... 28 6.5 >AF025467-2|AAN65301.1| 505|Caenorhabditis elegans Hypothetical protein R148.5b protein. Length = 505 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 613 LTSPFRRFPSYSYTPLRHPPIFCSLYLRKLKQRLVEC 503 L SPF P+ +P HPPIF +++ R +++EC Sbjct: 105 LDSPFANIPN---SP--HPPIFAAIFRRTTGVKVLEC 136 >AF025467-1|AAB71039.2| 528|Caenorhabditis elegans Hypothetical protein R148.5a protein. Length = 528 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 613 LTSPFRRFPSYSYTPLRHPPIFCSLYLRKLKQRLVEC 503 L SPF P+ +P HPPIF +++ R +++EC Sbjct: 105 LDSPFANIPN---SP--HPPIFAAIFRRTTGVKVLEC 136 >U42437-3|AAA83495.1| 297|Caenorhabditis elegans Hypothetical protein F30B5.6 protein. Length = 297 Score = 27.9 bits (59), Expect = 6.5 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +2 Query: 239 HECYSDRWVFRNSFIHLC 292 ++CY D W+FR +++C Sbjct: 165 NQCYFDFWMFREKLVYIC 182 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,656,287 Number of Sequences: 27780 Number of extensions: 237751 Number of successful extensions: 410 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -