BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0153 (743 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 30 1.9 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 4.3 At3g44730.1 68416.m04814 kinesin motor protein-related similar t... 28 7.5 At2g18250.1 68415.m02128 cytidylyltransferase domain-containing ... 28 7.5 At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain... 27 9.9 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 27 9.9 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -3 Query: 288 GRWCEATIRGISLNASKAEASLAESGKDMLTVEPRESGGSKQCD 157 G W + + S +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -1 Query: 662 RAKAGLIQMFSTHRDCESTAYRSFSIK 582 RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 291 RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At3g44730.1 68416.m04814 kinesin motor protein-related similar to 4 other kinesin-like proteins of A. thaliana: F02P16.12 (PID:g2191180), katA (D11371), katB (D21137), and katC (D21138); contains non-consensus AT-AC splice sites at intron 10 Length = 1087 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +2 Query: 308 PNVRNCGSSRTEQYYYRNDKPSVG*N*PVSRRSNPAHVP 424 P+ R+ + R RN KP V N PVSR PA VP Sbjct: 829 PSRRSLSTDRASTIKSRN-KPDVTQNLPVSRTPFPARVP 866 >At2g18250.1 68415.m02128 cytidylyltransferase domain-containing protein similar to CoA synthase [Mus musculus] GI:21780289, bifunctional phosphopantetheine adenylyl transferase / dephospho CoA kinase [Sus scrofa] GI:20465246; contains Pfam profile PF01467: Cytidylyltransferase Length = 176 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/58 (22%), Positives = 31/58 (53%) Frame = -3 Query: 261 GISLNASKAEASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRS 88 G+S+N +AE L++ +++ + S G+K T R +++ ++++ P + S Sbjct: 119 GLSVNRKRAERGLSQLKIEVVEIVSDGSSGNKISSSTLRKMEAEKASKQKQPAEEKAS 176 >At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing protein / MATH domain-containing protein Length = 564 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +2 Query: 11 EPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSH 163 +PR R LY D + + + K+T S+D+ NG + S+ E R+ + H Sbjct: 149 KPRKRMRLYGDGGAVSSHLHKETSSVDV---NGFQVLPSQAESVKRIFERH 196 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -1 Query: 239 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 99 RPK P A + ++WSP S A + + +VA + A D+ +D Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,494,288 Number of Sequences: 28952 Number of extensions: 343680 Number of successful extensions: 894 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -