BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0142 (599 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 2.6 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 2.6 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 7.9 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 462 IQNARRDVEAHLDRGDDAIGFF 527 +Q VEAHL +G AIG + Sbjct: 182 LQGISAPVEAHLRKGRGAIGAY 203 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 22.6 bits (46), Expect = 2.6 Identities = 15/58 (25%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = -2 Query: 577 HRTELYPDFGAVMHVLRKKPIASSPRSKWASTSRLAF--*MRNATSKVTLFRASRLSG 410 H + YP A + RK I S S W R+ + + A + L+ A + +G Sbjct: 252 HLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAG 309 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +1 Query: 469 TRDATSKPIWIAETMLSVFFLTRASRLR 552 TR+ ++ + E + V+F R +RLR Sbjct: 249 TREELAQRTKLTEARIQVWFSNRRARLR 276 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,088 Number of Sequences: 336 Number of extensions: 2701 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -