BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0141 (610 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 1.0 At1g65320.1 68414.m07407 CBS domain-containing protein contains ... 29 1.8 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 29 3.2 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 3.2 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 233 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 138 DS S RPS+DWF N+S + + SS+ Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At1g65320.1 68414.m07407 CBS domain-containing protein contains Pfam profile PF00571: CBS domain Length = 425 Score = 29.5 bits (63), Expect = 1.8 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = -1 Query: 496 IPITRPRKSPVSLFFVTTSRAGSG*FARLLPSLDVVA-VSQAPSPESNPDSPLPVTTMVV 320 IP+ R R +P FV S F +L SLD+VA +++ + +PV+ +V Sbjct: 44 IPVWRKRTTPSLPGFVENSEMRQQRFVGILNSLDIVAFLAKTECLQEEKAMKIPVSEVVS 103 Query: 319 AETTI 305 + T+ Sbjct: 104 PDNTL 108 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -1 Query: 415 RLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAE 314 RLLPSL VV+ +P+ + P S LP + + V E Sbjct: 84 RLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLE 117 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 406 PSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 299 PS A + APSP +NP P T V++ ES Sbjct: 39 PSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTES 74 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,133,447 Number of Sequences: 28952 Number of extensions: 279465 Number of successful extensions: 631 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 631 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -