BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0138 (737 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.69 SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces... 28 1.6 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.69 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 129 ARKIRGRPENAGPDPVRNVRRFSRV 55 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces pombe|chr 2|||Manual Length = 448 Score = 27.9 bits (59), Expect = 1.6 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 4/100 (4%) Frame = +1 Query: 58 SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234 ++ S+Y +WI VL+ +P + + +S +F S T++Q + Q + Sbjct: 335 TKNSAYFVEWIPDNVLKAVCSVPPKDLKMSATFIGNS-----TSIQEIFRRLGDQFSAMF 389 Query: 235 LIKT-KHWMALAGVDAM*FLPSXLNVN--VKKFKQARVNG 345 K HW G+D M F + N+N V +++Q + G Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAG 429 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,919,831 Number of Sequences: 5004 Number of extensions: 56859 Number of successful extensions: 123 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -