BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0131 (760 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57580.1 68418.m07194 calmodulin-binding protein similar to c... 28 7.7 At2g35890.1 68415.m04406 calcium-dependent protein kinase, putat... 28 7.7 At2g27810.2 68415.m03372 xanthine/uracil permease family protein... 28 7.7 At2g27810.1 68415.m03371 xanthine/uracil permease family protein... 28 7.7 >At5g57580.1 68418.m07194 calmodulin-binding protein similar to calmodulin-binding protein TCB60 GI:1698548 from [Nicotiana tabacum] Length = 647 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 191 WDPKDGELCLVRSKSGET-LMEAVAILTCKSIVGTGYRGERLIEPSSSWFRPK 346 W ++ E +V+ +SG+ L+ +T K VGT GE + +SSW R + Sbjct: 160 WTQEEFESHVVKERSGKRPLLTGEVYVTLKEGVGT--LGELVFTDNSSWIRSR 210 >At2g35890.1 68415.m04406 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK). [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 520 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 623 MTAGRWPWKSESAKECATTHLPKQPALKMDGAEAFC 730 +T+ WP SESAK+ L + P ++ + C Sbjct: 351 LTSDPWPQVSESAKDLIRKMLERNPIQRLTAQQVLC 386 >At2g27810.2 68415.m03372 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 660 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 579 PKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 680 P KR D+ VGRS DG +GS +P+R R+ Sbjct: 114 PVKRRRDSDGVVGRSNGPDGANGSGDPVRRPGRI 147 >At2g27810.1 68415.m03371 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 709 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 579 PKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 680 P KR D+ VGRS DG +GS +P+R R+ Sbjct: 114 PVKRRRDSDGVVGRSNGPDGANGSGDPVRRPGRI 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,185,095 Number of Sequences: 28952 Number of extensions: 378765 Number of successful extensions: 789 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -