BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf0130 (428 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||... 29 0.40 SPAC23H3.05c |swd1||COMPASS complex subunit Swd1|Schizosaccharom... 25 3.8 SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr... 25 5.0 SPBC16A3.14 |||mitochondrial ribosomal protein subunit S26|Schiz... 25 6.6 >SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 28.7 bits (61), Expect = 0.40 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +1 Query: 22 SVGGGAWPFLVGGAICLVNSGNERDSSLLNRRRYLGVRGLVSRNSLTT 165 ++ G L G + ++N G E D L N RYL V L N++TT Sbjct: 44 NIDAGTMSPLEHGEVFVLNDGGEVDLDLGNYERYLNVT-LTHDNNITT 90 >SPAC23H3.05c |swd1||COMPASS complex subunit Swd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 398 Score = 25.4 bits (53), Expect = 3.8 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 276 SFSVARVRPGHLRASQTCYCSISC 205 +FSV+RV GH RA Q+ C SC Sbjct: 55 TFSVSRVLTGHTRAIQS-VCWSSC 77 >SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 593 Score = 25.0 bits (52), Expect = 5.0 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 383 LLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENM 282 L G+P ++G++ P EG++ G EN+ Sbjct: 292 LYGVPSMYGVVTLPYSVREGINIFLDGHIPTENL 325 >SPBC16A3.14 |||mitochondrial ribosomal protein subunit S26|Schizosaccharomyces pombe|chr 2|||Manual Length = 277 Score = 24.6 bits (51), Expect = 6.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 64 ICLVNSGNERDSSLLNRRRYL 126 +CL N +D LLNR RY+ Sbjct: 227 LCLWNHAYYKDYGLLNRSRYI 247 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,680,081 Number of Sequences: 5004 Number of extensions: 29760 Number of successful extensions: 64 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 154448264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -